BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 005878
         (672 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3TIQ|A Chain A, Crystal Structure Of Staphylococcus Aureus Sasg G51-E-G52
           Module
 pdb|3TIQ|B Chain B, Crystal Structure Of Staphylococcus Aureus Sasg G51-E-G52
           Module
          Length = 214

 Score = 32.0 bits (71), Expect = 1.0,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 6/45 (13%)

Query: 577 PTNRVDAPGPE------RSENNNPDRVGNTMEIPGQPDLQQPETG 615
           P N +   GPE      R E +     G   E+PG+P ++ PETG
Sbjct: 75  PINELTEYGPETIAPGHRDEFDPKLPTGEKEEVPGKPGIKNPETG 119


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.137    0.425 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 18,662,435
Number of Sequences: 62578
Number of extensions: 723768
Number of successful extensions: 1763
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1763
Number of HSP's gapped (non-prelim): 1
length of query: 672
length of database: 14,973,337
effective HSP length: 105
effective length of query: 567
effective length of database: 8,402,647
effective search space: 4764300849
effective search space used: 4764300849
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 55 (25.8 bits)