Citrus Sinensis ID: 005918

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670

MQMQALGHIDFGLRSPLLVPAPQPRTSSKRPSISKLNTTTVSSASKWAHRLLADFQFTTADNSSLSSSSNTTVTLTPPPPTPTNRHVSIPIDFYQALGAETHFLGDGIRRAYEARISKPPQYGFSPDALISRRQILQAACETLANASSRREYNQGLADDHADTILTEVPWDKVPGALLVLQEAGETEVVLRIGESLLRERLPKSFKQDVVLAMALAYVDISRDAMAFNPPDYIGGCEMLERALKLLQEEGASSLAPDLQAQIDETLEEINPRCVLELLGLPLSGEYQARREEGLHGMLNILWAVGGGGATAIAGGFTRESFMNEAFLRMTSAEQVKLFSATPNSIPAETFEAYGVALALVAQAFVGKQPHLIADADNMFKHLQQNKVPTLRDLGSIYIPLEKHEMEFALERGLCSLLVGKLDECRLWLGLDSDKSPYRNPAIVDFVLENSKEADDNDLPGLCKLLETWLAEVVFPRFRDTSDIRFKLGDYYDDPTVLRYLERLEGNGSSPLAAAAAIVRIGATEATAVLDHVKSSTIQALQKVFPLGQGDKAVKYVEHGETYDPVPVVETEESLTSDQNNFAFTTDAYGTSSSDDIHGEQSITDKIKDVSVKIMCAGVAIGLVTLVGLKYLPTRNISSVQQKEIGLAKASDIIDAGKILRHVLASHPNIP

ccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccccccccHHHcccHHHHHHHHHccccccccHHHHHHHHHcccccccHHccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccccccccccccccccc

******G**DFGLRS*******************************W*HRLLADFQF****************************HVSIPIDFYQALGAETHFLGDGIRRAYEARISKPPQYGFSPDALISRRQILQAACETLANASSRREYNQGLADDHADTILTEVPWDKVPGALLVLQEAGETEVVLRIGESLLRERLPKSFKQDVVLAMALAYVDISRDAMAFNPPDYIGGCEMLERALKLLQEEGAS*LAPDLQAQIDETLEEINPRCVLELLGLPLSGEYQARREEGLHGMLNILWAVGGGGATAIAGGFTRESFMNEAFLRMTSAEQVKLFSATPNSIPAETFEAYGVALALVAQAFVGKQPHLIADADNMFKHLQQNKVPTLRDLGSIYIPLEKHEMEFALERGLCSLLVGKLDECRLWLGLDSDKSPYRNPAIVDFVLENSKEADDNDLPGLCKLLETWLAEVVFPRFRDTSDIRFKLGDYYDDPTVLRYLERLEGNGSSPLAAAAAIVRIGATEATAVLDHVKSSTIQALQKVFPLG***********************************F******************ITDKIKDVSVKIMCAGVAIGLVTLVGLKYLPTRNISSVQQKEIGLAKASDIIDAGKILRHVL*******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 6, chloroplastic	Component of the plastid division machinery. Involved in the initiation of proplastid and plastid division (including chloroplasts, statoliths and leukoplasts). Promotes the assembly and/or stabilization of the plastid-dividing FtsZ ring, functioning as an antagonistic regulator of FtsZ dynamics against CDP1. Relays plastid division site position between stroma and outer surface via interactions with the stromal FtsZ ring and the outer membrane PDV2 that recruits cytoplasmic ARC5 ring. Required for plastid equatorial positioning of PDV2 and ARC5. May contribute to gravitropism in stems and hypocotyls. Seems to influence stromule (stroma-filled tubular extensions of the plastid envelope membrane) length and frequency.	probable	Q9FIG9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QSA, chain A
Confidence level:confident
Coverage over the Query: 87-158
View the alignment between query and template
View the model in PyMOL