Citrus Sinensis ID: 005936

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------67

MQDLFGSVRRSIVFRTTAESTTDAQTANSPTPFSGGNLVERFNSCIRNSRVLSKHISPSVKMSPPIRWRKGELIGCGAFGRVYMGMNLDSGELLAVKQVLIAANFASKEKAQDHIKELEEEVKLLKDLSHPNIVRYLGTVREEESLNILLEFVPGGSISSLLGKFGPFPEAVMRTYTKQLLLGLEYLHNHGIMHRDIKGANILVDNKGCIKLADFGASKQVAELATVSGAKSMKGTPYWMAPEVIRQTGHSYSADIWSVGCTVIEMATGKPPWSQQYQEVAALFHIGTTKSHPPIPENLSVKAKDFLLKCLEKEPDLRPTASELLKHPFVTGDDEDPVLHASVMKSSEILSPSHVANLESLQMLTSPGSPGSVDICNLDSLSCSRVIVEKLSGSMHGWVTSNSNDDLCQLDQEDFVAGDRKLSSILAPNDLEKSRNPMCEPSDDWRWKFDGSPEPEKNELKPDSDESLKVPASRINASGEEDNGFSFPRGTPLSEDDDELTESKIKAFLDAKALELKKLQTPLYEEFYNSLNSACSPSFVESVCDETSPNYLKLPPKSRSPSRAPVGTSPVAVDAVSTESPGSNGNRASNIGVASNISAQENSSPQPESCSPSMSFSERQRKWKEELRQELEREREMMRQAGVGGKSSSPKDRVVNRQRDRTRFASPGK

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccECcccccccEEEEEEcccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccccCEEEcEEECccEEEEEEECcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccEEEcccccEEEccccccHHcccccccccccccccccccccHHHHccccccccccHHcHHHHHHHHHcccccccccccHHHHHHHcccccccccccccccHHHHHHHHHHHcccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccc

***********************************************************VKMSPPIRWRKGELIGCGAFGRVYMGMNLDSGELLAVKQVLIAANFASKE****HIKELEEEVKLLKDLSHPNIVRYLGTVREEESLNILLEFVPGGSISSLLGKFGPFPEAVMRTYTKQLLLGLEYLHNHGIMHRDIKGANILVDNKGCIKLADFGASKQVAELATVSGAKSMKGTPYWMAPEVIRQTGHSYSADIWSVGCTVIEMATGKPPWSQQYQEVAALFHIGTTKSHPPIPENLSVKAKDFLLKCLEKEPDLRPTASELLKHPFVT*****************************************VDICNLDSLSCSRVIVEKLSGSMHGWVTSNSNDDLCQLDQEDFVA**********************************************************************************LTESKIKAFLDAKALELKKLQTPLYEEFYNSLNSACSPSF*E**C*****************************************************************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MQDLFGSVRRSIVFRTTAESTTDAQTANSPTPFSGGNLVERFNSCIRNSRVLSKHISPSVKMSPPIRWRKGELIGCGAFGRVYMGMNLDSGELLAVKQVLxxxxxxxxxxxxxxxxxxxxxxxxxxxxSHPNIVRYLGTVREEESLNILLEFVPGGSISSLLGKFGPFPEAVMRTYTKQLLLGLEYLHNHGIMHRDIKGANILVDNKGCIKLADFGASKQVAELATVSGAKSMKGTPYWMAPEVIRQTGHSYSADIWSVGCTVIEMATGKPPWSQQYQEVAALFHIGTTKSHPPIPENLSVKAKDFLLKCLEKEPDLRPTASELLKHPFVTGDDEDPVLHASVMKSSEILSPSHVANLESLQMLTSPGSPGSVDICNLDSLSCSRVIVEKLSGSMHGWVTSNSNDDLCQLDQEDFVAGDRKLSSILAPNDLEKSRNPMCEPSDDWRWKFDGSPEPEKNELKPDSDESLKVPASRINASGEEDNGFSFPRGTPLSEDDDELTESKIKAFLDAKALELKKLQTPLYEEFYNSLNSACSPSFVESVCDETSPNYLKLPPKSRSPSRAPVGTSPVAVDAVSTESPGSNGNRASNIGVASNISAQENSSPQPESCSPSxxxxxxxxxxxxxxxxxxxxxxxxxxxxGVGGKSSSPKDRVVNRQRDRTRFASPGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Mitogen-activated protein kinase kinase kinase ANP1	May be involved in an oxidative stress-mediated signaling cascade that phosphorylates downstream MAP kinases MPK3 and MPK6. May suppress auxin signaling that promotes cell cycle. Functionally redundant to ANP2 and ANP3 in the positive regulation of cytokinesis.	probable	O22040
Mitogen-activated protein kinase kinase kinase 2	Involved in cortical microtubules organization and stabilization by regulating the phosphorylation state of microtubule-associated proteins such as MAP65-1.	probable	Q9FZ36

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.7.-.-	Transferring phosphorous-containing groups.	probable
2.7.11.-	Protein-serine/threonine kinases.	probable
2.7.11.25	Mitogen-activated protein kinase kinase kinase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CLQ, chain A
Confidence level:very confident
Coverage over the Query: 68-332
View the alignment between query and template
View the model in PyMOL

Template: 3Q5I, chain A
Confidence level:very confident
Coverage over the Query: 64-101,113-465,495-535
View the alignment between query and template
View the model in PyMOL

Template: 2LVV, chain A
Confidence level:probable
Coverage over the Query: 367-465,495-543
View the alignment between query and template
View the model in PyMOL