Citrus Sinensis ID: 005942

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------67

MDIVAIEAAYLAGDASGRSSAVALENISFGQLQALSVVPADSAALDPERSDTSCVITPPQIMEGKGVVKRFGSRVHVLPMHSDWFSPDTVHRLERQVVPHFFSGKSPDHTPEKYMECRNHIVAKYMDNPEKRLIVSDCQGLVDGVSPEDLTRIFRFLNHWGIINYCAAVQSPEPWNRGSYLREDSNGEVSVPSDALKSIDSLIKFDKPKCSLKVADVYSSSCGGADFFDLDNTIRERLSENHCNYCSQPIPAVYYQSQKEVDVLLCPECFHEGRFVTGHSSLDYIRVDPAREYGDIDGETWSDQETFLLLEGIEMYNDNWNEIAEHVSTKSKAQCILHFVRLPMEDGILENVEVPNTSRTSNSSSRDDRGGLHSTVNGDLPGAGLQEADMENRLPFSNSGNPVMALVAFLASAVGPRVAAACAHASLAALSKQMEGAGHGNRMNSENVHNREEENSGVHGPWGQNGAEAALLSAEKVKAAAKAGLAAAATKAKLFADHEEREIQRLSANIINHQLKRLELKLKQFAEVETLLMRECEQVEKARQRFATERTRIVSTRLGPGGVPSQMNLPVVAPSMVNNNIGNNRPQVMSASSSQPSIPGYSANQPVHPHMQFRPQQMFPLGQRMPLTSLQASSSAPSNVMFNARGGPQPTLNHPMIRSASGTSSGLG

ccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccHHHHHHcccccccccccccHHHHHHHHHHHHHHHccccccEEEHHHHHcccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccEECccccccccccHHHHHcccccccccccccEEccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*****IEAAYL******************************************************GVVKRFGSRVHVLPMHSDWFSPDTVHRLERQVVPHFFSGKSPDHTPEKYMECRNHIVAKYMDNPEKRLIVSDCQGLVDGVSPEDLTRIFRFLNHWGIINYCAAVQSPEPW**********************SIDSLIKF****CSLKVAD************DLDNTIRERLSENHCNYCSQPIPAVYYQSQKEVDVLLCPECFHEGRFVTGHSSLDYIRVDP******I*GETWSDQETFLLLEGIEMYNDNWNEIAEHVSTKSKAQCILHFVRLPMEDGILEN**************************************************PVMALVAFLASAVGPRVAAACAHASLA***************************************************************AKLFADHEEREIQRLSANIINHQLKRLELKLKQFAEVETLLMRECEQVEKA**RFATERTRI*******************************************************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDIVAIEAAYLAGDASGRSSAVALENISFGQLQALSVVPADSAALDPERSDTSCVITPPQIMEGKGVVKRFGSRVHVLPMHSDWFSPDTVHRLERQVVPHFFSGKSPDHTPEKYMECRNHIVAKYMDNPEKRLIVSDCQGLVDGVSPEDLTRIFRFLNHWGIINYCAAVQSPEPWNRGSYLREDSNGEVSVPSDALKSIDSLIKFDKPKCSLKVADVYSSSCGGADFFDLDNTIRERLSENHCNYCSQPIPAVYYQSQKEVDVLLCPECFHEGRFVTGHSSLDYIRVDPAREYGDIDGETWSDQETFLLLEGIEMYNDNWNEIAEHVSTKSKAQCILHFVRLPMEDGILENVEVPNTSRTSNSSSRDDRGGLHSTVNGDLPGAGLQEADMENRLPFSNSGNPVMALVAFLASAVGPRVAAACAHASLAALSKQMEGAGHGNRMNSENVHNREEENSGVHGPWGQNGAEAALLSAEKVKAAAKAGLAAAATKAKLFxxxxxxxxxxxxxxxxxxxxxRLELKLKQFAEVETLLMRECEQVEKARQRFATERTRIVSTRLGPGGVPSQMNLPVVAPSMVNNNIGNNRPQVMSASSSQPSIPGYSANQPVHPHMQFRPQQMFPLGQRMPLTSLQASSSAPSNVMFNARGGPQPTLNHPMIRSASGTSSGLG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
SWI/SNF complex subunit SWI3C	Component of a multiprotein complex equivalent of the SWI/SNF complex, an ATP-dependent chromatin-remodeling complex, which is required for the positive and negative regulation of gene expression of a large number of genes. It changes chromatin structure by altering DNA-histone contacts within a nucleosome, leading eventually to a change in nucleosome position, thus facilitating or repressing binding of gene-specific transcription factors.	probable	Q9XI07

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FQ3, chain A
Confidence level:very confident
Coverage over the Query: 82-167
View the alignment between query and template
View the model in PyMOL

Template: 2YUS, chain A
Confidence level:very confident
Coverage over the Query: 296-352
View the alignment between query and template
View the model in PyMOL

Template: 2E5R, chain A
Confidence level:confident
Coverage over the Query: 241-288
View the alignment between query and template
View the model in PyMOL