Citrus Sinensis ID: 006055

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660---

MAMQMQIESQNIFLLLLLIISTFSFSFSDLSSDRAALLALRSSVGGRTLLWNVYEASPCKWAGVECEQNRVTMLRLPGVALSGQIPLGILGNLTSLRTLSLRFNSLTSQLPSDLASCSNLRNLYLQGNHFSGEVPLFLVGLHHLVRLNLATNNFSGEIPSGFKNLTKLKTLFLENNRLSGSIPGFDDVLPNLQQLNVSNNLLNGSIPKRFQTFGSNSFLGNSLCGKPLQDCGTKASLVVPSTPSGTDEISHGEKEKKKLSGGAIAGIVIGSVIGFLLILLILLILCRKKSNRNTRSVDITSLKQQEVEIVDDKAVGEMDNGYSVAAAAAAAMVGIGNGNGKTQVNSNVNGATKKLVFFGNAARVFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTIVAVKRLKDVTISEREFKDKIEGVGAVNHENLVPLRAYYYSMDEKLLVYDYLTMGSLSALLHGNKGAGRTPLNWEMRSLIALGAARGIEYLHAQGPNVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPSSTPNRVAGYRAPEVTDPCKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSIVKDEWTSEVFDLELLRYQNVEEEMVQLLQLAIDCSAQYPDNRPSMSEVIKRIEELHPSSTQGHHGLQPDDLDNISSR

cccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccccccccccEEEEccccEEEEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHccccccccEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccCCcccccccccccccHHHHHHHHHHHcccccccccccccccccccccEEEEccccccccHHHHHHccccEEcccccccEEEEEEccccEEEEEEcccccccHHHHHHHHHHHcccccccccccEEEEEcccEEEEEEcccccccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccEECcccccCEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHccccccccccccccccccccccc

*********QNIFLLLLLIISTFSFSFSDLSSDRAALLALRSSVGGRTLLWNVYEASPCKWAGVECEQNRVTMLRLPGVALSGQIPLGILGNLTSLRTLSLRFNSLTSQLPSDLASCSNLRNLYLQGNHFSGEVPLFLVGLHHLVRLNLATNNFSGEIPSGFKNLTKLKTLFLENNRLSGSIPGFDDVLPNLQQLNVSNNLLNGSIPKRFQTFGSNSFLGNSLCGKPLQDCGTK**************************GGAIAGIVIGSVIGFLLILLILLILCRKK*****************VEIVDDKAVGEMDNGYSVAAAAAAAMVGIGN**************TKKLVFFGNAARVFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTIVAVKRLKDVTISEREFKDKIEGVGAVNHENLVPLRAYYYSMDEKLLVYDYLTMGSLSALLHGNKGAGRTPLNWEMRSLIALGAARGIEYLHAQGPNVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPSSTPNRVAGYRAPEVTDPCKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSIVKDEWTSEVFDLELLRYQNVEEEMVQLLQLAIDCSAQYPDNRPSMSEVIKR**************************

xxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable inactive receptor kinase At1g48480		probable	Q9LP77

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1O6V, chain A
Confidence level:very confident
Coverage over the Query: 68-226
View the alignment between query and template
View the model in PyMOL

Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 28-207
View the alignment between query and template
View the model in PyMOL

Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 363-643
View the alignment between query and template
View the model in PyMOL

Template: 3GVU, chain A
Confidence level:probable
Coverage over the Query: 351-579,593-645
View the alignment between query and template
View the model in PyMOL

Template: 2K1K, chain A
Confidence level:probable
Coverage over the Query: 258-289
View the alignment between query and template
View the model in PyMOL

Template: 3RIZ, chain A
Confidence level:probable
Coverage over the Query: 68-183
View the alignment between query and template
View the model in PyMOL