Citrus Sinensis ID: 006083

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660--
MAKGNNVTETENEEGSPPAPPSSNSSDATPPPSSTPSSSPPPSSPPPASPPPSSPPPSSPPPSKSPPSSPPPATSSSPPPASPPTSDNNKPDPPKNSPPPPPPSSQSSPTPPSPSNNKSPSPPVFSPPPPAKKSSPPPPPLKYSSSTPKSSSSSSKSSNGSSSGDDYVTYSVIGAVGVGIFLIAMIIICAVRANKKKKKRHNQPMHYYGDHSNHFKKGGDPYYSGGHAPNWHGHPEHQNWHSHPQGPDHTGGNIPPPPGGNWPGPPPPPPMMSSSGEMSSQFSGPARPPLPPPSPNIALGFNKSTFTYDELAAATGGFAKSNLLGQGGFGYVHKGVLPNGKEVAVKSLKTGSGQGEREFSAEVEIISRVHHRHLVSLVGYCIAGGQRMLVYEFVSNKTLEYHLHGENRPVMDFATRVRIALGSAKGLAYLHEDCHPRIIHRDIKAANILIDDNFEAMVADFGLAKLSNDNHTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSFGVMLLELITGRRPVDMTMMEDSLVEWARPLLGAALEDGIYDGLVDPRLEHNYVPHEMARLVACGAASIRHSARKRPKMSQIVRALEGDSSLDDLNDGVRPGQSSAFSASNTSTEYSATSYNADMKKFRQLALGSQDFASSDYGGSSDSREIPTPKQRI
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEEEEHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccEEEEEEcccccEEEEEEccccccccHHHHHHHHHHHHHccccccccEEEEEccccEEEEEEEEcccccHHHHHcccccccccHHHHHHHHHHccHHHHHHcccccccECcccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccc
**********************************************************************************************************************************************************************YVTYSVIGAVGVGIFLIAMIIICAVRA********************************************************************************************************ALGFNKSTFTYDELAAATGGFAKSNLLGQGGFGYVHKGVLPNGKEVAVKSLKTG***GEREFSAEVEIISRVHHRHLVSLVGYCIAGGQRMLVYEFVSNKTLEYHLHGENRPVMDFATRVRIALGSAKGLAYLHEDCHPRIIHRDIKAANILIDDNFEAMVADFGLAKLSNDNHTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSFGVMLLELITGRRPVDMTMMEDSLVEWARPLLGAALEDGIYDGLVDPRLEHNYVPHEMARLVACGAASIRHSARKRPKMSQIVRALEGDSSLDD*****************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKGNNVTETENEEGSPPAPPSSNSSDATPPPSSTPSSSPPPSSPPPASPPPSSPPPSSPPPSKSPPSSPPPATSSSPPPASPPTSDNNKPDPPKNSPPPPPPSSQSSPTPPSPSNNKSPSPPVFSPPPPAKKSSPPPPPLKYSSSTPKSSSSSSKSSNGSSSGDDYVTYSVIGAVGVGIFLIAMIIICAVRANKKKKKRHNQPMHYYGDHSNHFKKGGDPYYSGGHAPNWHGHPEHQNWHSHPQGPDHTGGNIPPPPGGNWPGPPPPPPMMSSSGEMSSQFSGPARPPLPPPSPNIALGFNKSTFTYDELAAATGGFAKSNLLGQGGFGYVHKGVLPNGKEVAVKSLKTGSGQGEREFSAEVEIISRVHHRHLVSLVGYCIAGGQRMLVYEFVSNKTLEYHLHGENRPVMDFATRVRIALGSAKGLAYLHEDCHPRIIHRDIKAANILIDDNFEAMVADFGLAKLSNDNHTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSFGVMLLELITGRRPVDMTMMEDSLVEWARPLLGAALEDGIYDGLVDPRLEHNYVPHEMARLVACGAASIRHSARKRPKMSQIVRALEGDSSLDDLNDGVRPGQSSAFSASNTSTEYSATSYNADMKKFRQLALGSQDFASSDYGGSSDSREIPTPKQRI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Proline-rich receptor-like protein kinase PERK4 Required during abscisic acid (ABA)-mediated activation of Ca(2+) channels. Regulates ABA signaling pathways. Modulates the expression of genes related to cell elongation and ABA signaling during root growth.probableQ9ZNQ8

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2H8H, chain A
Confidence level:very confident
Coverage over the Query: 314-593
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 303-595
View the alignment between query and template
View the model in PyMOL
Template: 1UU3, chain A
Confidence level:confident
Coverage over the Query: 309-467,479-517
View the alignment between query and template
View the model in PyMOL
Template: 2JED, chain A
Confidence level:probable
Coverage over the Query: 313-619
View the alignment between query and template
View the model in PyMOL
Template: 3DZY, chain A
Confidence level:probable
Coverage over the Query: 107-143
View the alignment between query and template
View the model in PyMOL
Template: 2L2T, chain A
Confidence level:probable
Coverage over the Query: 164-200
View the alignment between query and template
View the model in PyMOL
Template: 3GDB, chain A
Confidence level:probable
Coverage over the Query: 152-167
View the alignment between query and template
View the model in PyMOL