BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 006202
(657 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1Z2I|A Chain A, Crystal Structure Of Agrobacterium Tumefaciens Malate
Dehydrogenase, New York Structural Genomics Consortium
pdb|1Z2I|B Chain B, Crystal Structure Of Agrobacterium Tumefaciens Malate
Dehydrogenase, New York Structural Genomics Consortium
pdb|1Z2I|C Chain C, Crystal Structure Of Agrobacterium Tumefaciens Malate
Dehydrogenase, New York Structural Genomics Consortium
pdb|1Z2I|D Chain D, Crystal Structure Of Agrobacterium Tumefaciens Malate
Dehydrogenase, New York Structural Genomics Consortium
Length = 358
Score = 29.6 bits (65), Expect = 6.3, Method: Compositional matrix adjust.
Identities = 16/44 (36%), Positives = 22/44 (50%)
Query: 90 ASNTSNRGGRGGTDRYGVRSGAAYFTSNESGTLQSKPAYKKENG 133
A+ G R G D +GVR A Y T+ E G L +P + +G
Sbjct: 38 ATRAMMHGTRLGVDSHGVRLLAHYVTALEGGRLNRRPQISRVSG 81
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.309 0.125 0.361
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 18,277,907
Number of Sequences: 62578
Number of extensions: 709966
Number of successful extensions: 915
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 913
Number of HSP's gapped (non-prelim): 4
length of query: 657
length of database: 14,973,337
effective HSP length: 105
effective length of query: 552
effective length of database: 8,402,647
effective search space: 4638261144
effective search space used: 4638261144
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 55 (25.8 bits)