BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 006208
         (657 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|P14629|ERCC5_XENLA DNA repair protein complementing XP-G cells homolog OS=Xenopus
           laevis GN=ercc5 PE=2 SV=1
          Length = 1196

 Score = 33.1 bits (74), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 5/62 (8%)

Query: 3   KKPKIAQYRERLDKTLASPELTNEETLKMLVKNQLMHSSLDGNEGCSENV-----VERKT 57
           K+  +A+ R+R DK       TNE+ L+  +K Q + ++L GN+  +E +     V RK 
Sbjct: 84  KRQTLAKRRQRTDKASNDARKTNEKLLRTFLKRQAIKAALSGNKQSNEELPSFSQVPRKE 143

Query: 58  AE 59
            E
Sbjct: 144 TE 145


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.312    0.130    0.365 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 241,347,701
Number of Sequences: 539616
Number of extensions: 10368009
Number of successful extensions: 25773
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 193
Number of HSP's that attempted gapping in prelim test: 25555
Number of HSP's gapped (non-prelim): 403
length of query: 657
length of database: 191,569,459
effective HSP length: 124
effective length of query: 533
effective length of database: 124,657,075
effective search space: 66442220975
effective search space used: 66442220975
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)