Citrus Sinensis ID: 006259


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650---
MGNNCVGSRVSKDCLPQSISNSLWWSGSANVLPQHTKRSIQNGSKFAKEVEPPTSVQHKAPEPMKIVMDESVALEPQKVKGPETVKIVKDETVALEPQKVKDPEPMKIVKDENMAPEPQKIREGGKHKESESTTHNKYPQTSVPEKREETKPAQPAKPRKPHNVKRLSSAGLQAASVLQTKTGHLKEYYNLGRKLGNGQFGTTFLCMEKGTGKEYACKSIAKRKLIQKEDVEDVRREIQIMHHLAGHANAVLIKGAYEDSVAVHVVMELCAGGELFDRIIKKGHYTERKAAQLARTIVGFVETSHSLGVMHRDLKPENFLFVNEHEDSPLKAIDFGLSTFFKPGDIFTDVVGSPYYVSPEVLLKHYGPEADVWSAGVIIYILLSGVPPFWGETEHDIFEEVLHGDLDLSSDPWPKISENAKDLVRKMLVRDPRKRLTAHEVLCHPWFQIDGGAPDKPLDSAVLSRLKQFSAMNKLKKMALRVIAESLSEEEIAGLKEMFKALDADNSGFITFEELKVGLKRFGASLDESEIYDLMQAADVDNSGTIDYGEFIAATLHLNKAQREDHLFAAFSYFDKDGSGYITADELQQACDEFGIEDMRLEDLIREVDQDNDGRIDYNEFVAMMHNGNNEMGKKGGHGRSFSIGFREALQVC
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccEEEEEEEcccccEEEEEEEEccccccHHHHHHHHHHHHHHHHccccccEEEEEEEEEEcccEEEEEEcccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEccccccccccccccccccccccccHHHccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHccccccccccHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccEEHHHHHHHHccHHHHccHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccccccccccHHHHHccc
cccccccccccccccEEEEHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHEEccHHccccccEEEEEEEccccccEEEHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccEccEEEEEEcccEEEEEEEcccccEHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccEEcccccHHHEEEEccccccccEEEccccEEEEccccEEEcccccHHHHcHHHHHHHEccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccccccHHHHHHHHccccccHHHcccHHHHHcccccccccccccccEcHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccEcHHHHHHHHHHccccccHHHHHHHHHHccccccccEcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcHHHHHHHHHHcccccHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccccccccccHHHHHccc
mgnncvgsrvskdclpqsisnslwwsgsanvlpqhtkrsiqngskfakevepptsvqhkapepmkivmdesvalepqkvkgpetvkIVKDetvalepqkvkdpepmkivkdenmapepqkireggkhkesestthnkypqtsvpekreetkpaqpakprkphnvkrlssagLQAASVLQTKTGHLKEYYNLgrklgngqfgttflcmekgtgkeyaCKSIAKRKLIQKEDVEDVRREIQIMHHLAGHANAVLIKGAYEDSVAVHVVMELCAGGELFDRIIKKGHYTERKAAQLARTIVGFVEtshslgvmhrdlkpenflfvnehedsplkaidfglstffkpgdiftdvvgspyyvspevllkhygpeadvwSAGVIIYILLsgvppfwgetehDIFEEvlhgdldlssdpwpkiSENAKDLVRKMLVrdprkrltahevlchpwfqidggapdkpldSAVLSRLKQFSAMNKLKKMALRVIAESLSEEEIAGLKEMFKALdadnsgfiTFEELKVGLKRfgasldeseIYDLMqaadvdnsgtidyGEFIAATLHLNKAQREDHLFAAFSyfdkdgsgyitADELQQACDEFGIEDMRLEDLIRevdqdndgridYNEFVAMMHNgnnemgkkgghgrsfSIGFREALQVC
mgnncvgsrvskdclpqSISNSLWWSGSANVLPQHTKRSIQNGSKfakevepptsvqhkapepMKIVMDESValepqkvkgpetvkivkdetvalepqkvkdpepmkivkdenmapepqkireggkhkesestthnkypqtsvpekreetkpaqpakprkphnvkRLSSAGLQAASVLQTKTGHLKEYYNLGRKLGNGQFGTTFLCMEKGTGKeyacksiakrkliqkedvEDVRREIQIMHHLAGHANAVLIKGAYEDSVAVHVVMELCAGGELFDRIIKKGHYTERKAAQLARTIVGFVETSHSLGVMHRDLKPENFLFVNEHEDSPLKAIDFGLSTFFKPGDIFTDVVGSPYYVSPEVLLKHYGPEADVWSAGVIIYILLSGVPPFWGETEHDIFEEVLHGDLDLSSDPWPKISENAKDLVRKMLVRDPRKRLTAHEVLCHPWFQIDGGAPDKPLDSAVLSRLKQFSAMNKLKKMALRVIAESLSEEEIAGLKEMFKALDADNSGFITFEELKVGLKRFGASLDESEIYDLMQAADVDNSGTIDYGEFIAATLHLNKAQREDHLFAAFSYFDKDGSGYITADELQQACDEFGIEDMRLEDLIREVDQDNDGRIDYNEFVAMMHNGNNEMGKKGGHGRSFSIGFREALQVC
MGNNCVGSRVSKDCLPQSISNSLWWSGSANVLPQHTKRSIQNGSKFAKEVEPPTSVQHKAPEPMKIVMDESVALEPQKVKGPETVKIVKDETVALEPQKVKDPEPMKIVKDENMAPEPQKIREGGKHKESESTTHNKYPQTSVPEKREETKPAQPAKPRKPHNVKRLSSAGLQAASVLQTKTGHLKEYYNLGRKLGNGQFGTTFLCMEKGTGKEYACKSIAKRKLIQKEDVEDVRREIQIMHHLAGHANAVLIKGAYEDSVAVHVVMELCAGGELFDRIIKKGHYTERKAAQLARTIVGFVETSHSLGVMHRDLKPENFLFVNEHEDSPLKAIDFGLSTFFKPGDIFTDVVGSPYYVSPEVLLKHYGPEADVWSAGVIIYILLSGVPPFWGETEHDIFEEVLHGDLDLSSDPWPKISENAKDLVRKMLVRDPRKRLTAHEVLCHPWFQIDGGAPDKPLDSAVLSRLKQFSAMNKLKKMALRVIAESLSEEEIAGLKEMFKALDADNSGFITFEELKVGLKRFGASLDESEIYDLMQAADVDNSGTIDYGEFIAATLHLNKAQREDHLFAAFSYFDKDGSGYITADELQQACDEFGIEDMRLEDLIREVDQDNDGRIDYNEFVAMMHNGNNEMGKKGGHGRSFSIGFREALQVC
******************ISNSLWWSGS****************************************************************************************************************************************************VLQTKTGHLKEYYNLGRKLGNGQFGTTFLCMEKGTGKEYACKSIAKRKLIQKEDVEDVRREIQIMHHLAGHANAVLIKGAYEDSVAVHVVMELCAGGELFDRIIKKGHYTERKAAQLARTIVGFVETSHSLGVMHRDLKPENFLFVNEHEDSPLKAIDFGLSTFFKPGDIFTDVVGSPYYVSPEVLLKHYGPEADVWSAGVIIYILLSGVPPFWGETEHDIFEEVLHGDLDLSSDPWPKISENAKDLVRKMLVRDPRKRLTAHEVLCHPWFQIDGGAPD**LDSAVLSRLKQFSAMNKLKKMALRVIAESLSEEEIAGLKEMFKALDADNSGFITFEELKVGLKRFGASLDESEIYDLMQAADVDNSGTIDYGEFIAATLHLNKAQREDHLFAAFSYFDKDGSGYITADELQQACDEFGIEDMRLEDLIREVDQDNDGRIDYNEFVAMM****************************
*GNNCVGSRV*************************************************************************************************************************************************************************TKTGHLKEYYNLGRKLGNGQFGTTFLCMEKGTGKEYACKSIAKRKLIQKEDVEDVRREIQIMHHLAGHANAVLIKGAYEDSVAVHVVMELCAGGELFDRIIKKGHYTERKAAQLARTIVGFVETSHSLGVMHRDLKPENFLFVNEHEDSPLKAIDFGLSTFFKPGDIFTDVVGSPYYVSPEVLLKHYGPEADVWSAGVIIYILLSGVPPFWGETEHDIFEEVLHGDLDLSSDPWPKISENAKDLVRKMLVRDPRKRLTAHEVLCHPWFQIDGGAPDKPLDSAVLSRLKQFSAMNKLKKMALRVIAESLSEEEIAGLKEMFKALDADNSGFITFEELKVGLKRFGASLDESEIYDLMQAADVDNSGTIDYGEFIAATLHLNKAQREDHLFAAFSYFDKDGSGYITADELQQACDEFGIEDMRLEDLIREVDQDNDGRIDYNEFVAMM*********************REALQV*
*********VSKDCLPQSISNSLWWSGSANVLPQHTKRSIQNGSKF************KAPEPMKIVMDESVALEPQKVKGPETVKIVKDETVALEPQKVKDPEPMKIVKDENMAPEPQK***********************************************SSAGLQAASVLQTKTGHLKEYYNLGRKLGNGQFGTTFLCMEKGTGKEYACKSIAKRKLIQKEDVEDVRREIQIMHHLAGHANAVLIKGAYEDSVAVHVVMELCAGGELFDRIIKKGHYTERKAAQLARTIVGFVETSHSLGVMHRDLKPENFLFVNEHEDSPLKAIDFGLSTFFKPGDIFTDVVGSPYYVSPEVLLKHYGPEADVWSAGVIIYILLSGVPPFWGETEHDIFEEVLHGDLDLSSDPWPKISENAKDLVRKMLVRDPRKRLTAHEVLCHPWFQIDGGAPDKPLDSAVLSRLKQFSAMNKLKKMALRVIAESLSEEEIAGLKEMFKALDADNSGFITFEELKVGLKRFGASLDESEIYDLMQAADVDNSGTIDYGEFIAATLHLNKAQREDHLFAAFSYFDKDGSGYITADELQQACDEFGIEDMRLEDLIREVDQDNDGRIDYNEFVAMMHNGNNEMGKKGGHGRSFSIGFREALQVC
****CVGSRVSKDCLPQSISNSLWWS******************************************************************************************************************************************************VLQTKTGHLKEYYNLGRKLGNGQFGTTFLCMEKGTGKEYACKSIAKRKLIQKEDVEDVRREIQIMHHLAGHANAVLIKGAYEDSVAVHVVMELCAGGELFDRIIKKGHYTERKAAQLARTIVGFVETSHSLGVMHRDLKPENFLFVNEHEDSPLKAIDFGLSTFFKPGDIFTDVVGSPYYVSPEVLLKHYGPEADVWSAGVIIYILLSGVPPFWGETEHDIFEEVLHGDLDLSSDPWPKISENAKDLVRKMLVRDPRKRLTAHEVLCHPWFQIDGGAPDKPLDSAVLSRLKQFSAMNKLKKMALRVIAESLSEEEIAGLKEMFKALDADNSGFITFEELKVGLKRFGASLDESEIYDLMQAADVDNSGTIDYGEFIAATLHLNKAQREDHLFAAFSYFDKDGSGYITADELQQACDEFGIEDMRLEDLIREVDQDNDGRIDYNEFVAMMHN*****************GFRE***VC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNNCVGSRVSKDCLPQSISNSLWWSGSANVLPQHTKRSIQNGSKFAKEVEPPTSVQHKAPEPMKIVMDESVALEPQKVKGPETVKIVKDETVALEPQKVKDPEPMKIVKDENMAPEPQKIREGGKHKESESTTHNKYPQTSVPEKREETKPAQPAKPRKPHNVKRLSSAGLQAASVLQTKTGHLKEYYNLGRKLGNGQFGTTFLCMEKGTGKEYACKSIAKRKLIQKEDVEDVRREIQIMHHLAGHANAVLIKGAYEDSVAVHVVMELCAGGELFDRIIKKGHYTERKAAQLARTIVGFVETSHSLGVMHRDLKPENFLFVNEHEDSPLKAIDFGLSTFFKPGDIFTDVVGSPYYVSPEVLLKHYGPEADVWSAGVIIYILLSGVPPFWGETEHDIFEEVLHGDLDLSSDPWPKISENAKDLVRKMLVRDPRKRLTAHEVLCHPWFQIDGGAPDKPLDSAVLSRLKQFSAMNKLKKMALRVIAESLSEEEIAGLKEMFKALDADNSGFITFEELKVGLKRFGASLDESEIYDLMQAADVDNSGTIDYGEFIAATLHLNKAQREDHLFAAFSYFDKDGSGYITADELQQACDEFGIEDMRLEDLIREVDQDNDGRIDYNEFVAMMHNGNNEMGKKGGHGRSFSIGFREALQVC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query653 2.2.26 [Sep-21-2011]
Q38870646 Calcium-dependent protein yes no 0.969 0.979 0.663 0.0
Q06850610 Calcium-dependent protein no no 0.924 0.990 0.662 0.0
Q9ZV15583 Calcium-dependent protein no no 0.888 0.994 0.605 0.0
A5A7I7557 Calcium-dependent protein N/A no 0.794 0.931 0.666 0.0
A5A7I8535 Calcium-dependent protein N/A no 0.767 0.936 0.698 0.0
Q38872544 Calcium-dependent protein no no 0.776 0.931 0.677 0.0
Q38871556 Calcium-dependent protein no no 0.744 0.874 0.693 0.0
Q9SZM3484 Calcium-dependent protein no no 0.704 0.950 0.730 0.0
P28583508 Calcium-dependent protein no no 0.710 0.913 0.702 0.0
Q39016495 Calcium-dependent protein no no 0.719 0.949 0.667 0.0
>sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 Back     alignment and function desciption
 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/659 (66%), Positives = 507/659 (76%), Gaps = 26/659 (3%)

Query: 1   MGNNCVGSRVSKDCLPQSISNSLWWSGSANVLPQHTKRSIQNGSKFAKEV--EPPT-SVQ 57
           MGN CVG  +S +   Q+++ ++W      +  +    S     + +KE   EP T  VQ
Sbjct: 1   MGNACVGPNISGNGFLQTVTAAMW---RPRIGAEQASSSSHGNGQVSKEAASEPATDQVQ 57

Query: 58  HKAPEPMKIVMDESVALEPQKVKGPETVKIVKDETVALEPQKVK---DPEPMKIVKDEN- 113
           +K PEP+ +         P     PET K+  D  +  E +K K   +    K+V +E+ 
Sbjct: 58  NKPPEPITM---------PSSKTNPET-KLKPDLEIQPEEKKEKVLAEETKQKVVPEESK 107

Query: 114 --MAPEPQKIREGGKHKESES--TTHNKYPQTSVPEKREETKPAQPAKPRKPHNVKRLSS 169
             + PE  K RE     ES    T     P+T+ PE   ETKP   A+P+KP +++R+SS
Sbjct: 108 QEVPPEESK-REVVVQPESAKPETKSESKPETTKPETTSETKPETKAEPQKPKHMRRVSS 166

Query: 170 AGLQAASVLQTKTGHLKEYYNLGRKLGNGQFGTTFLCMEKGTGKEYACKSIAKRKLIQKE 229
           AGL+  SVLQ KT + KE+Y+LGRKLG GQFGTTFLC+EKGTG EYACKSI+KRKL+  E
Sbjct: 167 AGLRTESVLQRKTENFKEFYSLGRKLGQGQFGTTFLCLEKGTGNEYACKSISKRKLLTDE 226

Query: 230 DVEDVRREIQIMHHLAGHANAVLIKGAYEDSVAVHVVMELCAGGELFDRIIKKGHYTERK 289
           DVEDVRREIQIMHHLAGH N + IKGAYED VAVH+VMELC+GGELFDRII++GHYTERK
Sbjct: 227 DVEDVRREIQIMHHLAGHPNVISIKGAYEDVVAVHLVMELCSGGELFDRIIQRGHYTERK 286

Query: 290 AAQLARTIVGFVETSHSLGVMHRDLKPENFLFVNEHEDSPLKAIDFGLSTFFKPGDIFTD 349
           AA+LARTIVG +E  HSLGVMHRDLKPENFLFV+  EDS LK IDFGLS FFKP ++FTD
Sbjct: 287 AAELARTIVGVLEACHSLGVMHRDLKPENFLFVSREEDSLLKTIDFGLSMFFKPDEVFTD 346

Query: 350 VVGSPYYVSPEVLLKHYGPEADVWSAGVIIYILLSGVPPFWGETEHDIFEEVLHGDLDLS 409
           VVGSPYYV+PEVL K YGPE+DVWSAGVI+YILLSGVPPFW ETE  IFE+VLHGDLD S
Sbjct: 347 VVGSPYYVAPEVLRKRYGPESDVWSAGVIVYILLSGVPPFWAETEQGIFEQVLHGDLDFS 406

Query: 410 SDPWPKISENAKDLVRKMLVRDPRKRLTAHEVLCHPWFQIDGGAPDKPLDSAVLSRLKQF 469
           SDPWP ISE+AKDLVRKMLVRDP++RLTAH+VLCHPW QIDG APDKPLDSAVLSR+KQF
Sbjct: 407 SDPWPSISESAKDLVRKMLVRDPKRRLTAHQVLCHPWVQIDGVAPDKPLDSAVLSRMKQF 466

Query: 470 SAMNKLKKMALRVIAESLSEEEIAGLKEMFKALDADNSGFITFEELKVGLKRFGASLDES 529
           SAMNK KKMALRVIAESLSEEEIAGLK+MFK +DADNSG ITFEELK GLKR GA+L ES
Sbjct: 467 SAMNKFKKMALRVIAESLSEEEIAGLKQMFKMIDADNSGQITFEELKAGLKRVGANLKES 526

Query: 530 EIYDLMQAADVDNSGTIDYGEFIAATLHLNKAQREDHLFAAFSYFDKDGSGYITADELQQ 589
           EI DLMQAADVDNSGTIDY EFIAATLHLNK +REDHLFAAFSYFDKD SG+IT DELQQ
Sbjct: 527 EILDLMQAADVDNSGTIDYKEFIAATLHLNKIEREDHLFAAFSYFDKDESGFITPDELQQ 586

Query: 590 ACDEFGIEDMRLEDLIREVDQDNDGRIDYNEFVAMMHNGNNEMGK-KGGHGRSFSIGFR 647
           AC+EFG+ED R+E+++R+VDQD DGRIDYNEFVAMM  G+   G  K G   S SI  +
Sbjct: 587 ACEEFGVEDARIEEMMRDVDQDKDGRIDYNEFVAMMQKGSIMGGPVKMGLENSISISLK 645




May play a role in signal transduction pathways that involve calcium as a second messenger.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=2 SV=1 Back     alignment and function description
>sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 Back     alignment and function description
>sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 Back     alignment and function description
>sp|Q38872|CDPK6_ARATH Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana GN=CPK6 PE=1 SV=1 Back     alignment and function description
>sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=1 SV=1 Back     alignment and function description
>sp|Q9SZM3|CDPKQ_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 Back     alignment and function description
>sp|P28583|CDPK_SOYBN Calcium-dependent protein kinase SK5 OS=Glycine max PE=1 SV=1 Back     alignment and function description
>sp|Q39016|CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana GN=CPK11 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query653
255566207641 calcium-dependent protein kinase, putati 0.970 0.989 0.715 0.0
224088128613 calcium dependent protein kinase 26 [Pop 0.931 0.991 0.677 0.0
260408332587 calcium dependent protein kinase 1 [Goss 0.897 0.998 0.686 0.0
198446230583 calcium-dependent protein kinase [Gossyp 0.891 0.998 0.682 0.0
225463286580 PREDICTED: calcium-dependent protein kin 0.886 0.998 0.662 0.0
15228350646 calmodulin-domain protein kinase cdpk is 0.969 0.979 0.663 0.0
225463739569 PREDICTED: calcium-dependent protein kin 0.782 0.898 0.806 0.0
356498647587 PREDICTED: calcium-dependent protein kin 0.808 0.899 0.760 0.0
92110522625 putative calcium-dependent protein kinas 0.944 0.987 0.663 0.0
147780571580 hypothetical protein VITISV_039195 [Viti 0.886 0.998 0.659 0.0
>gi|255566207|ref|XP_002524091.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223536659|gb|EEF38301.1| calcium-dependent protein kinase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  923 bits (2386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/660 (71%), Positives = 524/660 (79%), Gaps = 26/660 (3%)

Query: 1   MGNNCVGSRVSKDCLPQSISNSLWW---SGSANVLPQHTKRSIQNGSKFAKEVEPPTSVQ 57
           MGNNCVGSR S+         S+WW        +   H K+    G  + K+ +  T+ Q
Sbjct: 1   MGNNCVGSRASQ---------SIWWLTHPTDCFLSHHHAKKEAIKGLPYNKQEQESTTSQ 51

Query: 58  --HKAPEPMKIVMDE-SVALEPQKVKGPETVKIVKDETVALEPQKVKD-PEPMKIVKDEN 113
             +  PE MKI  +E   A  P     P+     K    +   +++K  P P K  KDE 
Sbjct: 52  PQNTPPEQMKIAKEEIKQAALPASSAPPKQEANQKPALPSQPKEEIKQAPLPPK-PKDET 110

Query: 114 MAPEPQKIREGGKHKESESTTHNKYPQTSVPEKREETKPAQPAKPRKPHNVKRLSSAGLQ 173
           +  E   I    +  E +ST      Q SV   +EE KPA P +PRKPHNVKRL SAGL 
Sbjct: 111 VQSEVNGIIRN-QRGEIKSTR-----QVSV---KEEKKPAVPPRPRKPHNVKRLYSAGLL 161

Query: 174 AASVLQTKTGHLKEYYNLGRKLGNGQFGTTFLCMEKGTGKEYACKSIAKRKLIQKEDVED 233
           A SVL+TKTGHLKEYYNLGRKLG+GQFGTTFLC+EKGTGKEYACKSIAKRKL   +DVED
Sbjct: 162 AESVLRTKTGHLKEYYNLGRKLGHGQFGTTFLCVEKGTGKEYACKSIAKRKLSTIDDVED 221

Query: 234 VRREIQIMHHLAGHANAVLIKGAYEDSVAVHVVMELCAGGELFDRIIKKGHYTERKAAQL 293
           VRREIQIMHHL+G+ N + IKGAYED+VAVHVVMELCAGGELFDRIIK+GHYTERKAAQL
Sbjct: 222 VRREIQIMHHLSGNPNVISIKGAYEDAVAVHVVMELCAGGELFDRIIKRGHYTERKAAQL 281

Query: 294 ARTIVGFVETSHSLGVMHRDLKPENFLFVNEHEDSPLKAIDFGLSTFFKPGDIFTDVVGS 353
            RTIVG VE  HSLGVMHRDLKPENFLFVN  EDSPLKAIDFGLS FFKPG+IFTDVVGS
Sbjct: 282 TRTIVGVVEACHSLGVMHRDLKPENFLFVNNQEDSPLKAIDFGLSVFFKPGEIFTDVVGS 341

Query: 354 PYYVSPEVLLKHYGPEADVWSAGVIIYILLSGVPPFWGETEHDIFEEVLHGDLDLSSDPW 413
           PYYV+PEVL K YGPEADVWSAGV++YILLSGVPPFW ETE +IFEEVLHG LD +SDPW
Sbjct: 342 PYYVAPEVLKKRYGPEADVWSAGVMVYILLSGVPPFWAETEQEIFEEVLHGQLDFTSDPW 401

Query: 414 PKISENAKDLVRKMLVRDPRKRLTAHEVLCHPWFQIDGGAPDKPLDSAVLSRLKQFSAMN 473
           P ISE+AKDLVR+MLVRDPRKR+TAHEVLCHPW + DG APDKPLD AVLSR+KQFSAMN
Sbjct: 402 PHISESAKDLVRRMLVRDPRKRITAHEVLCHPWVRDDGVAPDKPLDPAVLSRMKQFSAMN 461

Query: 474 KLKKMALRVIAESLSEEEIAGLKEMFKALDADNSGFITFEELKVGLKRFGASLDESEIYD 533
           KLKKMALRVIAE+LSEEEIAGL EMFK +D DNSG ITFEELKVGL+RFGA+L+ESEIYD
Sbjct: 462 KLKKMALRVIAENLSEEEIAGLTEMFKMIDTDNSGQITFEELKVGLRRFGANLNESEIYD 521

Query: 534 LMQAADVDNSGTIDYGEFIAATLHLNKAQREDHLFAAFSYFDKDGSGYITADELQQACDE 593
           LMQAAD+DNSGTIDYGEFIAATLHLNK +REDHLFAAFSYFDKDGSGYIT DELQQAC E
Sbjct: 522 LMQAADIDNSGTIDYGEFIAATLHLNKVEREDHLFAAFSYFDKDGSGYITLDELQQACIE 581

Query: 594 FGIEDMRLEDLIREVDQDNDGRIDYNEFVAMMHNGNNEMGKKGGHGRSFSIGFREALQVC 653
           FG+ED+ LE++IREVDQDNDGRIDY EFVAMM  GN+EMGK G  G SFSIGFREALQVC
Sbjct: 582 FGMEDVHLEEMIREVDQDNDGRIDYKEFVAMMQKGNSEMGKNGLQGTSFSIGFREALQVC 641




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224088128|ref|XP_002308334.1| calcium dependent protein kinase 26 [Populus trichocarpa] gi|222854310|gb|EEE91857.1| calcium dependent protein kinase 26 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|260408332|gb|ACX37459.1| calcium dependent protein kinase 1 [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|198446230|gb|ACH88439.1| calcium-dependent protein kinase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|225463286|ref|XP_002264440.1| PREDICTED: calcium-dependent protein kinase 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|15228350|ref|NP_187677.1| calmodulin-domain protein kinase cdpk isoform 2 [Arabidopsis thaliana] gi|75319416|sp|Q38870.1|CDPK2_ARATH RecName: Full=Calcium-dependent protein kinase 2; AltName: Full=Calmodulin-domain protein kinase CDPK isoform 2 gi|9837343|gb|AAG00535.1|AF286222_1 calcium-dependent protein kinase isoform 2 [Arabidopsis thaliana] gi|12322803|gb|AAG51400.1|AC011560_32 calmodulin-domain protein kinase CDPK isoform 2; 13089-15758 [Arabidopsis thaliana] gi|1399271|gb|AAB03244.1| calmodulin-domain protein kinase CDPK isoform 2 [Arabidopsis thaliana] gi|8567800|gb|AAF76372.1| calmodulin-domain protein kinase CDPK isoform 2 [Arabidopsis thaliana] gi|209529779|gb|ACI49784.1| At3g10660 [Arabidopsis thaliana] gi|332641419|gb|AEE74940.1| calmodulin-domain protein kinase cdpk isoform 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225463739|ref|XP_002265450.1| PREDICTED: calcium-dependent protein kinase 1 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356498647|ref|XP_003518161.1| PREDICTED: calcium-dependent protein kinase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|92110522|gb|ABE73345.1| putative calcium-dependent protein kinase 2 [Isatis tinctoria] gi|92110524|gb|ABE73346.1| putative calcium-dependent protein kinase 2 [Isatis tinctoria] Back     alignment and taxonomy information
>gi|147780571|emb|CAN64630.1| hypothetical protein VITISV_039195 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query653
TAIR|locus:2075885646 CPK2 "calmodulin-domain protei 0.973 0.984 0.672 1.7e-224
TAIR|locus:2175503610 CPK1 "calcium dependent protei 0.849 0.909 0.735 4.9e-220
TAIR|locus:2065021583 CPK20 "calcium-dependent prote 0.846 0.948 0.658 4.3e-196
TAIR|locus:2122063556 CPK5 "calmodulin-domain protei 0.831 0.976 0.632 1.2e-186
TAIR|locus:2827528544 CPK6 "calcium dependent protei 0.803 0.965 0.660 1.7e-185
TAIR|locus:2014691495 CDPK2 "AT1G35670" [Arabidopsis 0.745 0.983 0.650 3.7e-174
TAIR|locus:2136917501 CPK4 "calcium-dependent protei 0.728 0.950 0.670 3.3e-173
TAIR|locus:2171726490 CDPK9 "calmodulin-like domain 0.705 0.940 0.663 1.6e-166
TAIR|locus:2177023528 CPK17 "calcium-dependent prote 0.747 0.924 0.617 1.9e-163
TAIR|locus:2150225523 CPK34 "AT5G19360" [Arabidopsis 0.701 0.875 0.647 1.9e-163
TAIR|locus:2075885 CPK2 "calmodulin-domain protein kinase cdpk isoform 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2167 (767.9 bits), Expect = 1.7e-224, P = 1.7e-224
 Identities = 441/656 (67%), Positives = 507/656 (77%)

Query:     1 MGNNCVGSRVSKDCLPQSISNSLWWSGSANVLPQHTKRSIQNGSKFAKEV--EPPTS-VQ 57
             MGN CVG  +S +   Q+++ ++W      +  +    S     + +KE   EP T  VQ
Sbjct:     1 MGNACVGPNISGNGFLQTVTAAMW---RPRIGAEQASSSSHGNGQVSKEAASEPATDQVQ 57

Query:    58 HKAPEPMKIVMDESVALEPQKVKGP-ETVKIVKDETVALEPQKVKD-PEPMKIVKDENMA 115
             +K PEP  I M  S      K+K   E     K E V  E  K K  PE  K    + + 
Sbjct:    58 NKPPEP--ITMPSSKTNPETKLKPDLEIQPEEKKEKVLAEETKQKVVPEESK----QEVP 111

Query:   116 PEPQKIREGGKHKES---ESTTHNKYPQTSVPEKREETKPAQPAKPRKPHNVKRLSSAGL 172
             PE  K RE     ES   E+ + +K P+T+ PE   ETKP   A+P+KP +++R+SSAGL
Sbjct:   112 PEESK-REVVVQPESAKPETKSESK-PETTKPETTSETKPETKAEPQKPKHMRRVSSAGL 169

Query:   173 QAASVLQTKTGHLKEYYNLGRKLGNGQFGTTFLCMEKGTGKEYACKSIAKRKLIQKEDVE 232
             +  SVLQ KT + KE+Y+LGRKLG GQFGTTFLC+EKGTG EYACKSI+KRKL+  EDVE
Sbjct:   170 RTESVLQRKTENFKEFYSLGRKLGQGQFGTTFLCLEKGTGNEYACKSISKRKLLTDEDVE 229

Query:   233 DVRREIQIMHHLAGHANAVLIKGAYEDSVAVHVVMELCAGGELFDRIIKKGHYTERKAAQ 292
             DVRREIQIMHHLAGH N + IKGAYED VAVH+VMELC+GGELFDRII++GHYTERKAA+
Sbjct:   230 DVRREIQIMHHLAGHPNVISIKGAYEDVVAVHLVMELCSGGELFDRIIQRGHYTERKAAE 289

Query:   293 LARTIVGFVETSHSLGVMHRDLKPENFLFVNEHEDSPLKAIDFGLSTFFKPGDIFTDVVG 352
             LARTIVG +E  HSLGVMHRDLKPENFLFV+  EDS LK IDFGLS FFKP ++FTDVVG
Sbjct:   290 LARTIVGVLEACHSLGVMHRDLKPENFLFVSREEDSLLKTIDFGLSMFFKPDEVFTDVVG 349

Query:   353 SPYYVSPEVLLKHYGPEADVWSAGVIIYILLSGVPPFWGETEHDIFEEVLHGDLDLSSDP 412
             SPYYV+PEVL K YGPE+DVWSAGVI+YILLSGVPPFW ETE  IFE+VLHGDLD SSDP
Sbjct:   350 SPYYVAPEVLRKRYGPESDVWSAGVIVYILLSGVPPFWAETEQGIFEQVLHGDLDFSSDP 409

Query:   413 WPKISENAKDLVRKMLVRDPRKRLTAHEVLCHPWFQIDGGAPDKPLDSAVLSRLKQFSAM 472
             WP ISE+AKDLVRKMLVRDP++RLTAH+VLCHPW QIDG APDKPLDSAVLSR+KQFSAM
Sbjct:   410 WPSISESAKDLVRKMLVRDPKRRLTAHQVLCHPWVQIDGVAPDKPLDSAVLSRMKQFSAM 469

Query:   473 NKLKKMALRVIAESLSEEEIAGLKEMFKALDADNSGFITFEELKVGLKRFGASLDESEIY 532
             NK KKMALRVIAESLSEEEIAGLK+MFK +DADNSG ITFEELK GLKR GA+L ESEI 
Sbjct:   470 NKFKKMALRVIAESLSEEEIAGLKQMFKMIDADNSGQITFEELKAGLKRVGANLKESEIL 529

Query:   533 DLMQAADVDNSGTIDYGEFIAATLHLNKAQREDHLFAAFSYFDKDGSGYITADELQQACD 592
             DLMQAADVDNSGTIDY EFIAATLHLNK +REDHLFAAFSYFDKD SG+IT DELQQAC+
Sbjct:   530 DLMQAADVDNSGTIDYKEFIAATLHLNKIEREDHLFAAFSYFDKDESGFITPDELQQACE 589

Query:   593 EFGIEDMRLEDLIREVDQDNDGRIDYNEFVAMMHNGNNEMGK-KGGHGRSFSIGFR 647
             EFG+ED R+E+++R+VDQD DGRIDYNEFVAMM  G+   G  K G   S SI  +
Sbjct:   590 EFGVEDARIEEMMRDVDQDKDGRIDYNEFVAMMQKGSIMGGPVKMGLENSISISLK 645




GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;NAS
GO:0004683 "calmodulin-dependent protein kinase activity" evidence=ISS
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0005789 "endoplasmic reticulum membrane" evidence=IDA
TAIR|locus:2175503 CPK1 "calcium dependent protein kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065021 CPK20 "calcium-dependent protein kinase 20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122063 CPK5 "calmodulin-domain protein kinase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827528 CPK6 "calcium dependent protein kinase 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014691 CDPK2 "AT1G35670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136917 CPK4 "calcium-dependent protein kinase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171726 CDPK9 "calmodulin-like domain protein kinase 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177023 CPK17 "calcium-dependent protein kinase 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150225 CPK34 "AT5G19360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q38870CDPK2_ARATH2, ., 7, ., 1, 1, ., 10.66310.96930.9798yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.10.991
3rd Layer2.7.110.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query653
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-94
pfam00069260 pfam00069, Pkinase, Protein kinase domain 3e-91
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 5e-64
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 2e-60
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 3e-55
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 5e-53
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 1e-50
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 7e-50
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 1e-46
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 7e-46
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 2e-44
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 1e-42
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 1e-42
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 2e-42
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 6e-42
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 2e-41
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 5e-41
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 2e-38
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 2e-38
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 4e-38
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 4e-38
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 8e-38
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 1e-37
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 1e-36
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 2e-36
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 2e-35
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 6e-35
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 5e-34
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 1e-33
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 2e-33
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 3e-33
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 6e-33
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 9e-33
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 1e-32
PTZ00426340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 1e-32
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 2e-32
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 6e-32
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 8e-32
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 1e-31
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 2e-31
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 3e-31
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 6e-31
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 6e-31
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 7e-31
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 7e-31
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 9e-31
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 1e-30
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 2e-30
cd05629377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 3e-30
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 5e-30
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 5e-30
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 6e-30
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 8e-30
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 9e-30
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 1e-29
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 1e-29
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 2e-29
PTZ00184149 PTZ00184, PTZ00184, calmodulin; Provisional 2e-29
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 4e-29
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 4e-29
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 4e-29
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 4e-29
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 6e-29
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 7e-29
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 7e-29
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 8e-29
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 1e-28
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 2e-28
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 2e-28
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 3e-28
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 5e-28
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 6e-28
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 6e-28
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 8e-28
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 8e-28
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 1e-27
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 1e-27
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 3e-27
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 3e-27
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 5e-27
cd05625382 cd05625, STKc_LATS1, Catalytic domain of the Prote 8e-27
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 9e-27
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 3e-26
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 4e-26
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 4e-26
cd05626381 cd05626, STKc_LATS2, Catalytic domain of the Prote 4e-26
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 5e-26
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 5e-26
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 5e-26
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 7e-26
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 9e-26
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 2e-25
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 2e-25
cd05622371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 3e-25
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 3e-25
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 7e-25
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 8e-25
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 9e-25
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 1e-24
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 2e-24
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 2e-24
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 2e-24
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 2e-24
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 3e-24
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 4e-24
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 4e-24
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 5e-24
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 7e-24
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 8e-24
PTZ00183158 PTZ00183, PTZ00183, centrin; Provisional 1e-23
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 1e-23
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 2e-23
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 7e-23
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 8e-23
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 2e-22
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 2e-22
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 3e-22
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 3e-22
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 3e-22
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 3e-22
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 6e-22
cd05623332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 7e-22
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 7e-22
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 1e-21
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 1e-21
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 2e-21
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 2e-21
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 2e-21
PHA03390267 PHA03390, pk1, serine/threonine-protein kinase 1; 3e-21
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 4e-21
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 4e-21
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 5e-21
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 6e-21
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 9e-21
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 1e-20
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 1e-20
cd07877345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 1e-20
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 1e-20
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 1e-20
cd07878343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 2e-20
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 2e-20
cd05618329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 2e-20
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 3e-20
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 5e-20
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 6e-20
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 6e-20
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 8e-20
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 8e-20
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 8e-20
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 9e-20
PTZ00267478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 9e-20
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 1e-19
cd07879342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 2e-19
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 2e-19
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 3e-19
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 4e-19
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 5e-19
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 7e-19
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 9e-19
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 1e-18
cd05617327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 1e-18
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 2e-18
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 2e-18
cd07865310 cd07865, STKc_CDK9, Catalytic domain of the Serine 2e-18
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 3e-18
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 3e-18
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 4e-18
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 6e-18
cd07842316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 8e-18
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 9e-18
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 1e-17
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 1e-17
cd05588329 cd05588, STKc_aPKC, Catalytic domain of the Protei 1e-17
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 2e-17
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 3e-17
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 3e-17
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 4e-17
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 4e-17
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 7e-17
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 9e-17
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 2e-16
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 3e-16
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 4e-16
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 5e-16
cd07859338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 8e-16
PTZ00036440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 9e-16
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 1e-15
cd07870291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 1e-15
PTZ00283496 PTZ00283, PTZ00283, serine/threonine protein kinas 1e-15
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 1e-15
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 2e-15
cd07876359 cd07876, STKc_JNK2, Catalytic domain of the Serine 2e-15
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 5e-15
cd07853372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 6e-15
cd05610669 cd05610, STKc_MASTL, Catalytic domain of the Prote 1e-14
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 1e-14
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 2e-14
cd06615308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 3e-14
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 3e-14
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 4e-14
cd07874355 cd07874, STKc_JNK3, Catalytic domain of the Serine 6e-14
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 7e-14
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 8e-14
cd07875364 cd07875, STKc_JNK1, Catalytic domain of the Serine 8e-14
cd07850353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 1e-13
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 7e-13
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 3e-12
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 3e-12
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 4e-12
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 7e-12
cd06650333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 7e-12
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 7e-12
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 8e-12
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 9e-12
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 9e-12
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 2e-11
PRK13184 932 PRK13184, pknD, serine/threonine-protein kinase; R 2e-11
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 2e-11
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 6e-11
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 1e-10
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 2e-10
cd07867317 cd07867, STKc_CDC2L6, Catalytic domain of Serine/T 2e-10
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 3e-10
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 3e-10
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 3e-10
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 4e-10
cd07868317 cd07868, STKc_CDK8, Catalytic domain of the Serine 6e-10
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 8e-10
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 2e-09
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 2e-09
cd08216314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 2e-09
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 3e-09
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 3e-09
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 3e-09
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 5e-09
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 7e-09
PHA03207392 PHA03207, PHA03207, serine/threonine kinase US3; P 8e-09
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 9e-09
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 9e-09
cd06649331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 9e-09
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 1e-08
cd05115257 cd05115, PTKc_Zap-70, Catalytic domain of the Prot 1e-08
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 2e-08
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 2e-08
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 2e-08
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 2e-08
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 2e-08
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 2e-08
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 4e-08
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 5e-08
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 7e-08
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 9e-08
cd05074273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 1e-07
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 1e-07
PHA03211461 PHA03211, PHA03211, serine/threonine kinase US3; P 2e-07
cd05046275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 3e-07
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 3e-07
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 4e-07
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 4e-07
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 4e-07
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 7e-07
PHA03212391 PHA03212, PHA03212, serine/threonine kinase US3; P 8e-07
smart0002796 smart00027, EH, Eps15 homology domain 8e-07
cd05089297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 9e-07
cd0005267 cd00052, EH, Eps15 homology domain; found in prote 1e-06
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 2e-06
cd05094291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 2e-06
cd05116257 cd05116, PTKc_Syk, Catalytic domain of the Protein 4e-06
cd05047270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 5e-06
PTZ00284467 PTZ00284, PTZ00284, protein kinase; Provisional 7e-06
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 9e-06
cd05054337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 1e-05
cd05106374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 1e-05
pfam0003629 pfam00036, efhand, EF hand 1e-05
cd05093288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 1e-05
cd05091283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 1e-05
cd05576237 cd05576, STKc_RPK118_like, Catalytic domain of the 1e-05
smart0005429 smart00054, EFh, EF-hand, calcium binding motif 1e-05
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 2e-05
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 2e-05
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 2e-05
pfam0003629 pfam00036, efhand, EF hand 3e-05
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 3e-05
cd05064266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 3e-05
pfam1340530 pfam13405, EF_hand_4, EF-hand domain 3e-05
smart0005429 smart00054, EFh, EF-hand, calcium binding motif 5e-05
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 7e-05
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 7e-05
cd05088303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 7e-05
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 7e-05
pfam1340530 pfam13405, EF_hand_4, EF-hand domain 8e-05
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 8e-05
cd05107401 cd05107, PTKc_PDGFR_beta, Catalytic domain of the 9e-05
PLN03224507 PLN03224, PLN03224, probable serine/threonine prot 1e-04
cd05097295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 1e-04
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 1e-04
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 1e-04
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 2e-04
cd05120155 cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphot 4e-04
pfam1320225 pfam13202, EF_hand_3, EF hand 4e-04
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 4e-04
cd05061288 cd05061, PTKc_InsR, Catalytic domain of the Protei 4e-04
cd0005267 cd00052, EH, Eps15 homology domain; found in prote 5e-04
cd05095296 cd05095, PTKc_DDR2, Catalytic domain of the Protei 5e-04
pfam0003629 pfam00036, efhand, EF hand 0.001
cd05105400 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the 0.001
cd05075272 cd05075, PTKc_Axl, Catalytic domain of the Protein 0.001
cd05111279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 0.001
PRK10819246 PRK10819, PRK10819, transport protein TonB; Provis 0.002
cd05102338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 0.002
cd05096304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 0.002
PHA03210501 PHA03210, PHA03210, serine/threonine kinase US3; P 0.002
smart0002796 smart00027, EH, Eps15 homology domain 0.004
pfam1320225 pfam13202, EF_hand_3, EF hand 0.004
cd05043280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 0.004
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 0.004
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
 Score =  292 bits (749), Expect = 1e-94
 Identities = 118/261 (45%), Positives = 159/261 (60%), Gaps = 9/261 (3%)

Query: 189 YNLGRKLGNGQFGTTFLCMEKGTGKEYACKSIAKRKLIQKEDVEDVRREIQIMHHLAGHA 248
           Y +  KLG G FG  +L  +K TGK  A K I K+K   K+D E + REI+I+  L  H 
Sbjct: 1   YEILEKLGEGSFGKVYLARDKKTGKLVAIKVIKKKK--IKKDRERILREIKILKKL-KHP 57

Query: 249 NAVLIKGAYEDSVAVHVVMELCAGGELFDRIIKKGHYTERKAAQLARTIVGFVETSHSLG 308
           N V +   +ED   +++VME C GG+LFD + K+G  +E +A    R I+  +E  HS G
Sbjct: 58  NIVRLYDVFEDEDKLYLVMEYCEGGDLFDLLKKRGRLSEDEARFYLRQILSALEYLHSKG 117

Query: 309 VMHRDLKPENFLFVNEHEDSPLKAIDFGLSTFFKPGDIFTDVVGSPYYVSPEVLL-KHYG 367
           ++HRDLKPEN L     ED  +K  DFGL+    PG+  T  VG+P Y++PEVLL K YG
Sbjct: 118 IVHRDLKPENILLD---EDGHVKLADFGLARQLDPGEKLTTFVGTPEYMAPEVLLGKGYG 174

Query: 368 PEADVWSAGVIIYILLSGVPPFWGETEHD-IFEEVLHGDLDLSSDPWPKISENAKDLVRK 426
              D+WS GVI+Y LL+G PPF G+ +   +F+++           W  IS  AKDL+RK
Sbjct: 175 KAVDIWSLGVILYELLTGKPPFPGDDQLLELFKKIGKPKPPFPPPEW-DISPEAKDLIRK 233

Query: 427 MLVRDPRKRLTAHEVLCHPWF 447
           +LV+DP KRLTA E L HP+F
Sbjct: 234 LLVKDPEKRLTAEEALQHPFF 254


Phosphotransferases. Serine or threonine-specific kinase subfamily. Length = 254

>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|185503 PTZ00183, PTZ00183, centrin; Provisional Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|197477 smart00027, EH, Eps15 homology domain Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|238009 cd00052, EH, Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|140307 PTZ00284, PTZ00284, protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|200946 pfam00036, efhand, EF hand Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|173667 cd05576, STKc_RPK118_like, Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>gnl|CDD|197492 smart00054, EFh, EF-hand, calcium binding motif Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|200946 pfam00036, efhand, EF hand Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>gnl|CDD|205583 pfam13405, EF_hand_4, EF-hand domain Back     alignment and domain information
>gnl|CDD|197492 smart00054, EFh, EF-hand, calcium binding motif Back     alignment and domain information
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|205583 pfam13405, EF_hand_4, EF-hand domain Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>gnl|CDD|178763 PLN03224, PLN03224, probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|240159 cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>gnl|CDD|205383 pfam13202, EF_hand_3, EF hand Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|238009 cd00052, EH, Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>gnl|CDD|200946 pfam00036, efhand, EF hand Back     alignment and domain information
>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|197477 smart00027, EH, Eps15 homology domain Back     alignment and domain information
>gnl|CDD|205383 pfam13202, EF_hand_3, EF hand Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 653
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0575 592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0598357 consensus Ribosomal protein S6 kinase and related 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0595429 consensus Serine/threonine-protein kinase involved 100.0
KOG0592604 consensus 3-phosphoinositide-dependent protein kin 100.0
KOG0616355 consensus cAMP-dependent protein kinase catalytic 100.0
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG0605550 consensus NDR and related serine/threonine kinases 100.0
KOG0583370 consensus Serine/threonine protein kinase [Signal 100.0
KOG0661538 consensus MAPK related serine/threonine protein ki 100.0
KOG0578550 consensus p21-activated serine/threonine protein k 100.0
KOG0600560 consensus Cdc2-related protein kinase [Cell cycle 100.0
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 100.0
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 100.0
KOG0663419 consensus Protein kinase PITSLRE and related kinas 100.0
KOG0694694 consensus Serine/threonine protein kinase [Signal 100.0
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 100.0
KOG0660359 consensus Mitogen-activated protein kinase [Signal 100.0
KOG0611 668 consensus Predicted serine/threonine protein kinas 100.0
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 100.0
KOG0585576 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 100.0
KOG0198313 consensus MEKK and related serine/threonine protei 100.0
KOG0582516 consensus Ste20-like serine/threonine protein kina 100.0
KOG0610459 consensus Putative serine/threonine protein kinase 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 100.0
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 100.0
KOG4717 864 consensus Serine/threonine protein kinase [Signal 100.0
KOG0607463 consensus MAP kinase-interacting kinase and relate 100.0
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
KOG0201467 consensus Serine/threonine protein kinase [Signal 100.0
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 100.0
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 100.0
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 100.0
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 100.0
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 100.0
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 100.0
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 100.0
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 100.0
KOG0192362 consensus Tyrosine kinase specific for activated ( 100.0
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 100.0
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 100.0
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 100.0
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 100.0
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 100.0
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 100.0
KOG0690516 consensus Serine/threonine protein kinase [Signal 100.0
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 100.0
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 100.0
PLN00034353 mitogen-activated protein kinase kinase; Provision 100.0
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 100.0
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 100.0
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 100.0
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 100.0
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 100.0
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 100.0
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 100.0
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 100.0
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 100.0
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 100.0
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 100.0
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 100.0
PTZ00284467 protein kinase; Provisional 100.0
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 100.0
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 100.0
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 100.0
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 100.0
PHA03212391 serine/threonine kinase US3; Provisional 100.0
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 100.0
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 100.0
PTZ00036440 glycogen synthase kinase; Provisional 100.0
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 100.0
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 100.0
KOG0589426 consensus Serine/threonine protein kinase [General 100.0
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 100.0
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 100.0
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 100.0
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 100.0
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 100.0
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 100.0
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 100.0
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 100.0
KOG0596677 consensus Dual specificity; serine/threonine and t 100.0
KOG0586596 consensus Serine/threonine protein kinase [General 100.0
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 100.0
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 100.0
KOG0577 948 consensus Serine/threonine protein kinase [Signal 100.0
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 100.0
PTZ00267478 NIMA-related protein kinase; Provisional 100.0
PTZ00283496 serine/threonine protein kinase; Provisional 100.0
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 100.0
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 100.0
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 100.0
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 100.0
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 100.0
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 100.0
PTZ00266 1021 NIMA-related protein kinase; Provisional 100.0
KOG0574502 consensus STE20-like serine/threonine kinase MST [ 100.0
KOG0986591 consensus G protein-coupled receptor kinase [Signa 100.0
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 100.0
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 100.0
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 100.0
KOG0197468 consensus Tyrosine kinases [Signal transduction me 100.0
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 100.0
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 100.0
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 100.0
PHA03211461 serine/threonine kinase US3; Provisional 100.0
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 100.0
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 100.0
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 100.0
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 100.0
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 100.0
PHA03207392 serine/threonine kinase US3; Provisional 100.0
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 100.0
KOG0696683 consensus Serine/threonine protein kinase [Signal 100.0
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 100.0
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 100.0
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 100.0
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 100.0
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 100.0
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 100.0
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 100.0
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 100.0
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 100.0
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 100.0
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 100.0
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 100.0
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 100.0
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 100.0
PHA02988283 hypothetical protein; Provisional 100.0
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 100.0
PHA03209357 serine/threonine kinase US3; Provisional 100.0
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 100.0
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 100.0
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 100.0
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 100.0
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 100.0
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 100.0
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 100.0
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 100.0
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 100.0
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 100.0
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 100.0
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 100.0
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 100.0
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 100.0
KOG0671415 consensus LAMMER dual specificity kinases [Signal 100.0
KOG1989 738 consensus ARK protein kinase family [Signal transd 100.0
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 100.0
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 100.0
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 100.0
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 100.0
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 100.0
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 100.0
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 100.0
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 100.0
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 100.0
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 100.0
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 100.0
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 100.0
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 100.0
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 100.0
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 100.0
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 100.0
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 100.0
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 100.0
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 100.0
KOG0584 632 consensus Serine/threonine protein kinase [General 100.0
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 100.0
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 100.0
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 100.0
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 100.0
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 100.0
PLN00009294 cyclin-dependent kinase A; Provisional 100.0
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 100.0
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 100.0
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 100.0
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 100.0
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 100.0
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 100.0
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 100.0
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 100.0
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 100.0
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 100.0
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 100.0
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 100.0
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 100.0
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 100.0
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 100.0
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 100.0
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 100.0
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 100.0
KOG4721 904 consensus Serine/threonine protein kinase, contain 100.0
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 100.0
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 100.0
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 100.0
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 100.0
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 100.0
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 100.0
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 100.0
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 100.0
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 100.0
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 100.0
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 100.0
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 100.0
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 100.0
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 100.0
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 100.0
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 100.0
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 100.0
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 100.0
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 100.0
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 100.0
PHA03210501 serine/threonine kinase US3; Provisional 100.0
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 100.0
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 100.0
PTZ00024335 cyclin-dependent protein kinase; Provisional 100.0
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 100.0
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 100.0
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 100.0
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 100.0
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 100.0
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 100.0
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 100.0
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 100.0
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 100.0
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 100.0
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 100.0
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 100.0
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 100.0
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 100.0
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 100.0
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 100.0
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 100.0
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 100.0
KOG06081034 consensus Warts/lats-like serine threonine kinases 100.0
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 100.0
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 100.0
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 100.0
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 100.0
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 100.0
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 100.0
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 100.0
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 100.0
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 100.0
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 100.0
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 100.0
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 100.0
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 100.0
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 100.0
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 100.0
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 100.0
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 100.0
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 100.0
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 100.0
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 100.0
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 100.0
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 100.0
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 100.0
KOG0695593 consensus Serine/threonine protein kinase [Signal 100.0
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 100.0
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 100.0
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 100.0
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 100.0
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 100.0
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 100.0
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 100.0
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 100.0
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 100.0
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 100.0
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 100.0
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 100.0
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 100.0
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 100.0
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 100.0
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 100.0
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 100.0
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 100.0
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 100.0
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 100.0
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 100.0
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 100.0
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 100.0
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 100.0
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 100.0
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 100.0
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 100.0
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 100.0
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 100.0
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 100.0
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 100.0
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 100.0
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 100.0
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 100.0
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 100.0
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 100.0
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 100.0
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 100.0
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 100.0
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 100.0
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 100.0
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 100.0
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 100.0
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 100.0
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 100.0
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 100.0
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 100.0
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 100.0
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 100.0
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 100.0
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 100.0
KOG1187361 consensus Serine/threonine protein kinase [Signal 100.0
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 100.0
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 100.0
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 100.0
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 100.0
KOG1026774 consensus Nerve growth factor receptor TRKA and re 100.0
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 100.0
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 100.0
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 100.0
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 100.0
KOG1151775 consensus Tousled-like protein kinase [Signal tran 100.0
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 100.0
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 100.0
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 100.0
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 100.0
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 100.0
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 100.0
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 100.0
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 100.0
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 100.0
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 100.0
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 100.0
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 100.0
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 100.0
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 100.0
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 100.0
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 100.0
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 100.0
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 100.0
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 100.0
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 100.0
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 100.0
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 100.0
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 100.0
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 100.0
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 100.0
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 100.0
PHA02882294 putative serine/threonine kinase; Provisional 100.0
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 100.0
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 100.0
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 100.0
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 100.0
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 100.0
KOG1290590 consensus Serine/threonine protein kinase [Signal 100.0
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 100.0
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 100.0
PLN03224507 probable serine/threonine protein kinase; Provisio 100.0
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 100.0
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 100.0
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 100.0
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 100.0
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 100.0
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 100.0
KOG1027903 consensus Serine/threonine protein kinase and endo 100.0
KOG0576 829 consensus Mitogen-activated protein kinase kinase 100.0
KOG1167418 consensus Serine/threonine protein kinase of the C 100.0
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.98
KOG1152772 consensus Signal transduction serine/threonine kin 99.98
KOG10251177 consensus Epidermal growth factor receptor EGFR an 99.97
KOG3653534 consensus Transforming growth factor beta/activin 99.97
KOG2052513 consensus Activin A type IB receptor, serine/threo 99.97
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.97
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.97
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.96
PLN00181 793 protein SPA1-RELATED; Provisional 99.96
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.96
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.94
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.94
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.94
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.93
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.93
PRK09188365 serine/threonine protein kinase; Provisional 99.92
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.92
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.92
KOG1165449 consensus Casein kinase (serine/threonine/tyrosine 99.91
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.91
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.9
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.88
PRK12274218 serine/threonine protein kinase; Provisional 99.88
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.88
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.87
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.87
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.87
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 99.84
PRK10345210 hypothetical protein; Provisional 99.84
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 99.83
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.83
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.81
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 99.81
PTZ00183158 centrin; Provisional 99.8
PTZ00184149 calmodulin; Provisional 99.8
smart00090237 RIO RIO-like kinase. 99.79
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.79
PRK14879211 serine/threonine protein kinase; Provisional 99.77
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 99.77
KOG0590 601 consensus Checkpoint kinase and related serine/thr 99.76
KOG1023484 consensus Natriuretic peptide receptor, guanylate 99.74
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.73
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.73
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.73
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.7
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 99.69
KOG06061205 consensus Microtubule-associated serine/threonine 99.66
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.65
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.64
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.63
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 99.63
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 99.56
KOG0036 463 consensus Predicted mitochondrial carrier protein 99.51
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 99.46
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 99.44
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.43
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.37
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.36
KOG1266458 consensus Protein kinase [Signal transduction mech 99.29
KOG3087229 consensus Serine/threonine protein kinase [General 99.28
PLN02964 644 phosphatidylserine decarboxylase 99.27
KOG1243 690 consensus Protein kinase [General function predict 99.26
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 99.2
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 99.19
KOG0038189 consensus Ca2+-binding kinase interacting protein 99.18
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 99.17
KOG3741655 consensus Poly(A) ribonuclease subunit [RNA proces 99.17
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 99.16
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 99.13
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 99.12
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 99.1
KOG0377631 consensus Protein serine/threonine phosphatase RDG 99.07
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.02
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 99.02
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 98.96
COG4248 637 Uncharacterized protein with protein kinase and he 98.96
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.95
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.92
cd0005267 EH Eps15 homology domain; found in proteins implic 98.9
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.9
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.89
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.89
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 98.88
PTZ00183158 centrin; Provisional 98.88
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.87
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.84
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.83
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.82
KOG2137 700 consensus Protein kinase [Signal transduction mech 98.81
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 98.81
PTZ00184149 calmodulin; Provisional 98.8
PLN02964 644 phosphatidylserine decarboxylase 98.77
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.77
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.76
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 98.75
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 98.74
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.7
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.69
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.68
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.66
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.66
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.66
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.65
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 98.63
COG0478304 RIO-like serine/threonine protein kinase fused to 98.61
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.6
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
Probab=100.00  E-value=1.6e-60  Score=484.29  Aligned_cols=267  Identities=40%  Similarity=0.677  Sum_probs=246.8

Q ss_pred             cccccceeEeceecccCCeEEEEEEEcCCCcEEEEEEeeccccCCh----hhHHHHHHHHHHHHHhcCCCCeeEEEEEEE
Q 006259          183 GHLKEYYNLGRKLGNGQFGTTFLCMEKGTGKEYACKSIAKRKLIQK----EDVEDVRREIQIMHHLAGHANAVLIKGAYE  258 (653)
Q Consensus       183 ~~~~~~y~i~~~LG~G~fG~Vy~~~~~~~g~~vAvK~i~~~~~~~~----~~~~~~~~Ei~~l~~l~~hpnIv~l~~~~~  258 (653)
                      ..+.++|.+.+.||+|+||.|-+|.++.||+.||||++.++.....    .....+.+|+++|++|+ |||||+++++|+
T Consensus       168 ks~~d~yii~~~LGsGafg~Vkla~e~~tgk~vAiKIi~krk~~~~s~~~~~~~~v~~EieILkkL~-HP~IV~~~d~f~  246 (475)
T KOG0615|consen  168 KSFNDYYIISKTLGSGAFGLVKLAYEKKTGKQVAIKIINKRKSTGCSRAIAKTRDVQNEIEILKKLS-HPNIVRIKDFFE  246 (475)
T ss_pred             chhcceeEeeeeecCCceeEEEEEEEcccCcEEEeeeeehhhcccccccccchhhhHHHHHHHHhcC-CCCEEEEeeeee
Confidence            3477899999999999999999999999999999999998876442    23445789999999998 999999999999


Q ss_pred             eCCeEEEEEeccCCCChHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHCCCeecCCCCCcEEEeeCCCCCCeEEeecccc
Q 006259          259 DSVAVHVVMELCAGGELFDRIIKKGHYTERKAAQLARTIVGFVETSHSLGVMHRDLKPENFLFVNEHEDSPLKAIDFGLS  338 (653)
Q Consensus       259 ~~~~~~lV~E~~~ggsL~~~l~~~~~~~~~~~~~i~~qil~aL~~LH~~~iiHrDlKp~NILl~~~~~~~~iKL~DFGla  338 (653)
                      .....||||||+.||+|++++..++.+.+...+.+++||+.||.|||++||+||||||+|||+.++.++..+||+|||+|
T Consensus       247 ~~ds~YmVlE~v~GGeLfd~vv~nk~l~ed~~K~~f~Qll~avkYLH~~GI~HRDiKPeNILl~~~~e~~llKItDFGlA  326 (475)
T KOG0615|consen  247 VPDSSYMVLEYVEGGELFDKVVANKYLREDLGKLLFKQLLTAVKYLHSQGIIHRDIKPENILLSNDAEDCLLKITDFGLA  326 (475)
T ss_pred             cCCceEEEEEEecCccHHHHHHhccccccchhHHHHHHHHHHHHHHHHcCcccccCCcceEEeccCCcceEEEecccchh
Confidence            99999999999999999999999999999999999999999999999999999999999999988778899999999999


Q ss_pred             cccCCCCcccccccCCCCCChHHhhc----CCCChhhhHHHHHHHHHHHhCCCCCCCCCHHH-HHHHHHcCCCCCCCCCC
Q 006259          339 TFFKPGDIFTDVVGSPYYVSPEVLLK----HYGPEADVWSAGVIIYILLSGVPPFWGETEHD-IFEEVLHGDLDLSSDPW  413 (653)
Q Consensus       339 ~~~~~~~~~~~~~gt~~Y~APE~l~~----~~~~~~DIwSlGvil~eLltg~~Pf~~~~~~~-~~~~i~~~~~~~~~~~~  413 (653)
                      +....+....+.||||.|.|||++..    .|..++|||||||+||.+++|.+||.+..... +.++|..|.+.+....|
T Consensus       327 K~~g~~sfm~TlCGTpsYvAPEVl~~kg~~~~~~kVDiWSlGcvLfvcLsG~pPFS~~~~~~sl~eQI~~G~y~f~p~~w  406 (475)
T KOG0615|consen  327 KVSGEGSFMKTLCGTPSYVAPEVLASKGVEYYPSKVDIWSLGCVLFVCLSGYPPFSEEYTDPSLKEQILKGRYAFGPLQW  406 (475)
T ss_pred             hccccceehhhhcCCccccChhheecCCeecccchheeeeccceEEEEeccCCCcccccCCccHHHHHhcCcccccChhh
Confidence            99988888899999999999999973    24568999999999999999999998765544 88999999999999999


Q ss_pred             cCCCHHHHHHHHHhccCCCCCCCCHHHHhcCCccccc
Q 006259          414 PKISENAKDLVRKMLVRDPRKRLTAHEVLCHPWFQID  450 (653)
Q Consensus       414 ~~~s~~l~~li~~~L~~dP~~Rpt~~elL~hp~f~~~  450 (653)
                      ..+++++++||.+||..||++|||+.|+|+||||+..
T Consensus       407 ~~Iseea~dlI~~mL~VdP~~R~s~~eaL~hpW~~~~  443 (475)
T KOG0615|consen  407 DRISEEALDLINWMLVVDPENRPSADEALNHPWFKDA  443 (475)
T ss_pred             hhhhHHHHHHHHHhhEeCcccCcCHHHHhcChhhhcc
Confidence            9999999999999999999999999999999999854



>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query653
3igo_A486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 4e-85
3i79_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 7e-81
3ku2_A507 Crystal Structure Of Inactivated Form Of Cdpk1 From 7e-81
3hx4_A508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 8e-81
3i7c_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 5e-78
3lij_A494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 9e-76
3hzt_A467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 4e-75
3q5i_A504 Crystal Structure Of Pbanka_031420 Length = 504 1e-71
2aao_A166 Regulatory Apparatus Of Calcium Dependent Protein K 2e-71
2qg5_A294 Cryptosporidium Parvum Calcium Dependent Protein Ki 4e-62
3f3z_A277 Crystal Structure Of Cryptosporidium Parvum Calcium 6e-62
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 3e-59
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 2e-58
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 3e-58
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 3e-58
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 4e-58
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 6e-58
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 7e-58
2w4o_A349 Crystal Structure Of Human Camk4 In Complex With 4- 2e-57
1s6i_A188 Ca2+-Regulatory Region (Cld) From Soybean Calcium-D 9e-57
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 1e-56
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 2e-53
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 1e-52
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 7e-52
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 8e-52
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 9e-52
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 1e-51
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 2e-51
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 2e-51
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 2e-51
3f5u_A295 Crystal Structure Of The Death Associated Protein K 2e-51
3bhy_A283 Crystal Structure Of Human Death Associated Protein 2e-51
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 2e-51
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 2e-51
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 3e-51
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 6e-51
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 8e-51
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 8e-51
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 1e-50
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 2e-50
2wel_A327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 4e-50
2a27_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 9e-50
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 1e-49
1wmk_A321 Human Death-Associated Kinase Drp-1, Mutant S308d D 1e-49
2ya9_A361 Crystal Structure Of The Autoinhibited Form Of Mous 1e-49
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 2e-49
1z9x_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 2e-49
1zws_A288 Crystal Structure Of The Catalytic Domain Of Human 2e-49
2a2a_A321 High-resolution Crystallographic Analysis Of The Au 3e-49
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 6e-49
3soa_A444 Full-Length Human Camkii Length = 444 6e-48
2bdw_A362 Crystal Structure Of The Auto-Inhibited Kinase Doma 5e-47
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 1e-45
3kk8_A284 Camkii Substrate Complex A Length = 284 2e-45
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 2e-45
3kk9_A282 Camkii Substrate Complex B Length = 282 2e-45
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 7e-45
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 9e-45
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 1e-44
3mfr_A351 Cask-4m Cam Kinase Domain, Native Length = 351 1e-43
2wnt_A330 Crystal Structure Of The Human Ribosomal Protein S6 2e-43
3rny_A346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 2e-43
2x4f_A373 The Crystal Structure Of The Human Myosin Light Cha 3e-43
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 1e-42
2ycr_A323 Crystal Structure Of Checkpoint Kinase 2 In Complex 3e-42
2w0j_A323 Crystal Structure Of Chk2 In Complex With Nsc 10955 3e-42
2xk9_A322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 3e-42
2qr8_A342 2.0a X-ray Structure Of C-terminal Kinase Domain Of 3e-42
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 3e-42
2cn5_A329 Crystal Structure Of Human Chk2 In Complex With Adp 4e-42
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 8e-42
3kn5_A325 Crystal Structure Of The C-Terminal Kinase Domain O 9e-42
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 2e-41
3tac_A361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 2e-41
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 2e-41
1kob_A387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 3e-41
3c0g_A351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 3e-41
2qr7_A342 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of 5e-41
1koa_A491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 2e-40
2hw6_A307 Crystal Structure Of Mnk1 Catalytic Domain Length = 2e-40
3uto_A573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 3e-40
3r1n_A317 Mk3 Kinase Bound To Compound 5b Length = 317 8e-39
3fhr_A336 High Resolution Crystal Structure Of Mitogen-Activa 9e-39
2oza_A356 Structure Of P38alpha Complex Length = 356 3e-38
1kwp_A400 Crystal Structure Of Mapkap2 Length = 400 4e-38
2onl_C406 Crystal Structure Of The P38a-Mapkap Kinase 2 Heter 4e-38
3ka0_A320 Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4 5e-38
3fpm_A325 Crystal Structure Of A Squarate Inhibitor Bound To 7e-38
2pzy_A324 Structure Of Mk2 Complexed With Compound 76 Length 7e-38
3r2b_A318 Mk2 Kinase Bound To Compound 5b Length = 318 7e-38
2jbo_A326 Protein Kinase Mk2 In Complex With An Inhibitor (Cr 7e-38
2p3g_X327 Crystal Structure Of A Pyrrolopyridine Inhibitor Bo 8e-38
3r2y_A319 Mk2 Kinase Bound To Compound 1 Length = 319 8e-38
3gok_A334 Binding Site Mapping Of Protein Ligands Length = 33 9e-38
2ac5_A316 Structure Of Human Mnk2 Kinase Domain Mutant D228g 2e-37
2ac3_A316 Structure Of Human Mnk2 Kinase Domain Length = 316 1e-36
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-36
1nxk_A400 Crystal Structure Of Staurosporine Bound To Map Kap 3e-36
2wzj_A327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 3e-36
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 3e-36
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 5e-36
1zmw_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 8e-36
3iec_A319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 1e-35
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 1e-35
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 2e-35
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 2e-35
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 2e-35
1tki_A321 Autoinhibited Serine Kinase Domain Of The Giant Mus 4e-35
3h4j_B336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 4e-35
2xck_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 4e-35
2y94_A476 Structure Of An Active Form Of Mammalian Ampk Lengt 5e-35
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 6e-35
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 1e-34
3hko_A345 Crystal Structure Of A Cdpk Kinase Domain From Cryp 1e-34
2r7b_A312 Crystal Structure Of The Phosphoinositide-Dependent 1e-34
1uu3_A310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 2e-34
3iop_A312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 2e-34
3h9o_A311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 2e-34
3orx_A316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 2e-34
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 2e-34
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 2e-34
2xch_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 2e-34
3sc1_A311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 2e-34
3rwp_A311 Discovery Of A Novel, Potent And Selective Inhibito 2e-34
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 2e-34
3zgw_A347 Crystal Structure Of Maternal Embryonic Leucine Zip 3e-34
3lm0_A327 Crystal Structure Of Human SerineTHREONINE KINASE 1 5e-34
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 6e-34
3nus_A286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 6e-34
1z5m_A286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 7e-34
1uu9_A286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 7e-34
1h1w_A289 High Resolution Crystal Structure Of The Human Pdk1 7e-34
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 7e-34
3pwy_A311 Crystal Structure Of An Extender (Spd28345)-Modifie 8e-34
3nay_A311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 9e-34
3nun_A292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 1e-33
3ujg_A361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 1e-33
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 1e-33
3hrc_A311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 1e-33
3zuu_A362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 2e-33
3udb_A317 Crystal Structure Of Snrk2.6 Length = 317 2e-33
1y8g_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-33
3uc4_A362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 4e-33
3zut_A362 The Structure Of Ost1 (D160a) Kinase Length = 362 8e-33
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 2e-32
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 2e-32
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 3e-32
3nx8_A351 Human Camp Dependent Protein Kinase In Complex With 3e-32
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 3e-32
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 3e-32
3l9m_A351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 3e-32
1xh9_A350 Crystal Structures Of Protein Kinase B Selective In 4e-32
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 4e-32
4dfy_A371 Crystal Structure Of R194a Mutant Of Camp-Dependent 4e-32
2f7e_E351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 4e-32
3ama_A351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 4e-32
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 4e-32
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 4e-32
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 4e-32
3agm_A351 Complex Of Pka With The Bisubstrate Protein Kinase 5e-32
3mvj_A371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 5e-32
4ae6_A343 Structure And Function Of The Human Sperm-specific 5e-32
3agl_A351 Complex Of Pka With The Bisubstrate Protein Kinase 5e-32
1ydt_E350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 6e-32
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 7e-32
2uzt_A336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 7e-32
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 8e-32
1smh_A350 Protein Kinase A Variant Complex With Completely Or 8e-32
4ae9_A343 Structure And Function Of The Human Sperm-specific 9e-32
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 9e-32
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 1e-31
2hak_A328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 1e-31
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 1e-31
2gu8_A337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 1e-31
1cdk_A350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 1e-31
1ctp_E350 Structure Of The Mammalian Catalytic Subunit Of Cam 1e-31
1cmk_E350 Crystal Structures Of The Myristylated Catalytic Su 1e-31
1syk_A350 Crystal Structure Of E230q Mutant Of Camp-Dependent 1e-31
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 1e-31
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 1e-31
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 2e-31
3fhi_A350 Crystal Structure Of A Complex Between The Catalyti 2e-31
2qur_A350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 2e-31
1q61_A350 Pka Triple Mutant Model Of Pkb Length = 350 2e-31
3kga_A299 Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexe 2e-31
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 2e-31
1fmo_E350 Crystal Structure Of A Polyhistidine-Tagged Recombi 2e-31
1j3h_A350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 2e-31
2erz_E351 Crystal Structure Of C-amp Dependent Kinase (pka) B 2e-31
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 2e-31
1bkx_A350 A Binary Complex Of The Catalytic Subunit Of Camp-D 2e-31
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 2e-31
2c1a_A351 Structure Of Camp-Dependent Protein Kinase Complexe 2e-31
1stc_E350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 2e-31
2gnj_A350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 2e-31
1svh_A350 Crystal Structure Of Protein Kinase A In Complex Wi 2e-31
3dnd_A350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 2e-31
1jbp_E350 Crystal Structure Of The Catalytic Subunit Of Camp- 2e-31
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 2e-31
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 2e-31
1szm_A350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 3e-31
1apm_E350 2.0 Angstrom Refined Crystal Structure Of The Catal 3e-31
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 3e-31
4dg3_E371 Crystal Structure Of R336a Mutant Of Camp-dependent 3e-31
1l3r_E350 Crystal Structure Of A Transition State Mimic Of Th 3e-31
1q24_A350 Pka Double Mutant Model Of Pkb In Complex With Mgat 3e-31
2qcs_A350 A Complex Structure Between The Catalytic And Regul 3e-31
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 3e-31
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 4e-31
1q8w_A350 The Catalytic Subunit Of Camp-Dependent Protein Kin 4e-31
3pvb_A345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 4e-31
4dfx_E350 Crystal Structure Of Myristoylated K7c Catalytic Su 4e-31
2jds_A351 Structure Of Camp-Dependent Protein Kinase Complexe 4e-31
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 4e-31
1xh7_A350 Crystal Structures Of Protein Kinase B Selective In 4e-31
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 4e-31
2jdt_A351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 5e-31
2vo0_A351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 5e-31
2gng_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 6e-31
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 6e-31
2gnf_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 6e-31
3o7l_B350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 7e-31
2uvy_A351 Structure Of Pka-pkb Chimera Complexed With Methyl- 8e-31
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 8e-31
3qam_E350 Crystal Structure Of Glu208ala Mutant Of Catalytic 8e-31
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 9e-31
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 1e-30
3qal_E350 Crystal Structure Of Arg280ala Mutant Of Catalytic 1e-30
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 2e-30
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 2e-30
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 2e-30
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 2e-30
1rdq_E350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 2e-30
3uc3_A361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 4e-30
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 5e-30
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 1e-29
4fie_A423 Full-Length Human Pak4 Length = 423 2e-29
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 4e-29
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 2e-28
3txo_A353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 2e-28
1mrv_A339 Crystal Structure Of An Inactive Akt2 Kinase Domain 2e-28
1o6l_A337 Crystal Structure Of An Activated Akt/protein Kinas 3e-28
2jdo_A342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 3e-28
1gzn_A335 Structure Of Pkb Kinase Domain Length = 335 3e-28
1gzk_A315 Molecular Mechanism For The Regulation Of Protein K 3e-28
3e87_A335 Crystal Structures Of The Kinase Domain Of Akt2 In 3e-28
1o6k_A336 Structure Of Activated Form Of Pkb Kinase Domain S4 3e-28
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 2e-27
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 3e-27
2jed_A352 The Crystal Structure Of The Kinase Domain Of The P 5e-27
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 1e-26
1xjd_A345 Crystal Structure Of Pkc-Theta Complexed With Staur 1e-26
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 1e-26
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 1e-26
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 1e-26
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 1e-26
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 2e-26
3ocb_A341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 2e-26
4gv1_A340 Pkb Alpha In Complex With Azd5363 Length = 340 2e-26
3cqu_A342 Crystal Structure Of Akt-1 Complexed With Substrate 2e-26
4fsy_A279 Crystal Structure Of The Chk1 Length = 279 3e-26
2r0u_A323 Crystal Structure Of Chek1 In Complex With Inhibito 3e-26
2hog_A322 Crystal Structure Of Chek1 In Complex With Inhibito 3e-26
4fsz_A279 Crystal Structure Of The Chk1 Length = 279 3e-26
2br1_A297 Structure-Based Design Of Novel Chk1 Inhibitors: In 4e-26
1ia8_A289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 4e-26
1zlt_A295 Crystal Structure Of Chk1 Complexed With A Hymenald 4e-26
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 4e-26
4fsn_A278 Crystal Structure Of The Chk1 Length = 278 4e-26
2ydj_A276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 4e-26
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 4e-26
4fsm_A279 Crystal Structure Of The Chk1 Length = 279 5e-26
3jvr_A271 Characterization Of The Chk1 Allosteric Inhibitor B 5e-26
3ot3_A273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 5e-26
2x8e_A276 Discovery Of A Novel Class Of Triazolones As Checkp 5e-26
4fsw_A279 Crystal Structure Of The Chk1 Length = 279 6e-26
2e9v_A268 Structure Of H-Chk1 Complexed With A859017 Length = 6e-26
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 6e-26
2ghg_A269 H-Chk1 Complexed With A431994 Length = 269 6e-26
2ayp_A269 Crystal Structure Of Chk1 With An Indol Inhibitor L 6e-26
1zys_A273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 6e-26
4fst_A269 Crystal Structure Of The Chk1 Length = 269 6e-26
4ft3_A279 Crystal Structure Of The Chk1 Length = 279 7e-26
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 7e-26
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 9e-26
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 9e-26
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 1e-25
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-25
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 2e-25
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 2e-25
2r5t_A373 Crystal Structure Of Inactive Serum And Glucocortic 2e-25
4fsu_A279 Crystal Structure Of The Chk1 Length = 279 2e-25
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 2e-25
3pm8_A197 Cad Domain Of Pff0520w, Calcium Dependent Protein K 2e-25
3iw4_A360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 2e-25
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 3e-25
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 4e-25
1s6j_A87 N-Terminal Region Of The Ca2+-Saturated Calcium Reg 4e-25
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 8e-25
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 1e-24
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 2e-24
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 2e-24
2f2u_A402 Crystal Structure Of The Rho-Kinase Kinase Domain L 3e-24
3e3p_A360 Glycogen Synthase Kinase From Leishmania Major Leng 6e-24
2esm_A415 Crystal Structure Of Rock 1 Bound To Fasudil Length 7e-24
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 8e-24
3v8s_A410 Human Rho-Associated Protein Kinase 1 (Rock 1) In C 8e-24
2v55_A406 Mechanism Of Multi-site Phosphorylation From A Rock 9e-24
4agu_A311 Crystal Structure Of The Human Cdkl1 Kinase Domain 2e-23
2zv2_A298 Crystal Structure Of Human CalciumCALMODULIN-Depend 2e-23
4apc_A350 Crystal Structure Of Human Nima-Related Kinase 1 (N 2e-23
3u0k_A440 Crystal Structure Of The Genetically Encoded Calciu 4e-23
3sg6_A450 Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) L 5e-23
3evu_A449 Crystal Structure Of Calcium Bound Dimeric Gcamp2, 6e-23
3ek8_A449 Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER L 6e-23
3ekh_A449 Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER 6e-23
3pfq_A674 Crystal Structure And Allosteric Activation Of Prot 6e-23
3sg5_A448 Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linke 7e-23
3o78_A415 The Structure Of Ca2+ Sensor (Case-12) Length = 415 7e-23
3o77_A415 The Structure Of Ca2+ Sensor (Case-16) Length = 415 7e-23
2f2o_A179 Structure Of Calmodulin Bound To A Calcineurin Pept 7e-23
3sg2_A449 Crystal Structure Of Gcamp2-T116v,D381y Length = 44 7e-23
3evr_A411 Crystal Structure Of Calcium Bound Monomeric Gcamp2 8e-23
3sg4_A448 Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Len 8e-23
4dc2_A396 Structure Of Pkc In Complex With A Substrate Peptid 1e-22
3sg7_A448 Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 4 1e-22
2i0e_A353 Structure Of Catalytic Domain Of Human Protein Kina 1e-22
3sg3_A449 Crystal Structure Of Gcamp3-D380y Length = 449 1e-22
3dls_A335 Crystal Structure Of Human Pas Kinase Bound To Adp 1e-22
4djc_A152 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCA 1e-22
4e7w_A394 Structure Of Gsk3 From Ustilago Maydis Length = 394 1e-22
1iq5_A149 CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE 2e-22
2wel_D150 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 2e-22
2ygg_B150 Complex Of Cambr And Cam Length = 150 2e-22
2be6_A150 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaC 2e-22
1exr_A148 The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Ca 2e-22
1xfu_O149 Crystal Structure Of Anthrax Edema Factor (ef) Trun 2e-22
3ewt_A154 Crystal Structure Of Calmodulin Complexed With A Pe 3e-22
1cm1_A148 Motions Of Calmodulin-Single-Conformer Refinement L 3e-22
1prw_A149 Crystal Structure Of Bovine Brain Ca++ Calmodulin I 3e-22
1up5_B148 Chicken Calmodulin Length = 148 3e-22
1cdl_A147 Target Enzyme Recognition By Calmodulin: 2.4 Angstr 3e-22
1ooj_A149 Structural Genomics Of Caenorhabditis Elegans : Cal 3e-22
2bkh_B149 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 3e-22
2k0j_A148 Solution Structure Of Cam Complexed To Drp1p Length 4e-22
2vb6_B149 Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigo 5e-22
2bbm_A148 Solution Structure Of A Calmodulin-Target Peptide C 5e-22
2lv6_A148 The Complex Between Ca-calmodulin And Skeletal Musc 5e-22
1clm_A148 Structure Of Paramecium Tetraurelia Calmodulin At 1 5e-22
1dmo_A148 Calmodulin, Nmr, 30 Structures Length = 148 7e-22
1ahr_A146 Calmodulin Mutant With A Two Residue Deletion In Th 8e-22
2vay_A146 Calmodulin Complexed With Cav1.1 Iq Peptide Length 8e-22
4gow_D144 Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX 9e-22
1cdm_A144 Modulation Of Calmodulin Plasticity In Molecular Re 9e-22
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 9e-22
4aw2_A437 Crystal Structure Of Cdc42 Binding Protein Kinase A 9e-22
2ix7_A145 Structure Of Apo-Calmodulin Bound To Unconventional 1e-21
3a8w_A345 Crystal Structure Of Pkciota Kinase Domain Length = 1e-21
3zh8_A349 A Novel Small Molecule Apkc Inhibitor Length = 349 1e-21
3k21_A191 Crystal Structure Of Carboxy-Terminus Of Pfc0420w L 2e-21
4aaa_A331 Crystal Structure Of The Human Cdkl2 Kinase Domain 2e-21
1y0v_H146 Crystal Structure Of Anthrax Edema Factor (Ef) In C 3e-21
1k93_D144 Crystal Structure Of The Adenylyl Cyclase Domain Of 3e-21
3qfv_A415 Mrck Beta In Complex With Tpca-1 Length = 415 4e-21
3tku_A433 Mrck Beta In Complex With Fasudil Length = 433 4e-21
1yxs_A293 Crystal Structure Of Kinase Pim1 With P123m Mutatio 5e-21
1deg_A142 The Linker Of Des-Glu84 Calmodulin Is Bent As Seen 6e-21
2xj0_A301 Protein Kinase Pim-1 In Complex With Fragment-4 Fro 8e-21
3uix_A298 Crystal Structure Of Pim1 Kinase In Complex With Sm 8e-21
1qtx_A148 The 1.65 Angstrom Structure Of Calmodulin Rs20 Pept 8e-21
1xqz_A300 Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolut 9e-21
2xix_A301 Protein Kinase Pim-1 In Complex With Fragment-1 Fro 9e-21
2xiy_A301 Protein Kinase Pim-1 In Complex With Fragment-2 Fro 9e-21
2wtk_C305 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 9e-21
3f2a_A300 Crystal Structure Of Human Pim-1 In Complex With Da 9e-21
1vrk_A148 The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 9e-21
3a99_A320 Structure Of Pim-1 Kinase Crystallized In The Prese 1e-20
3jxw_A294 Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4- 1e-20
4alv_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 1e-20
3r00_A299 The Discovery Of Novel Benzofuran-2-Carboxylic Acid 1e-20
1xws_A313 Crystal Structure Of The Human Pim1 Kinase Domain L 1e-20
1ywv_A293 Crystal Structures Of Proto-Oncogene Kinase Pim1: A 1e-20
1zrz_A364 Crystal Structure Of The Catalytic Domain Of Atypic 1e-20
2iwi_A312 Crystal Structure Of The Human Pim2 In Complex With 1e-20
2obj_A333 Crystal Structure Of Human Pim-1 Kinase In Complex 1e-20
3dcv_A328 Crystal Structure Of Human Pim1 Kinase Complexed Wi 1e-20
4a7c_A308 Crystal Structure Of Pim1 Kinase With Etp46546 Leng 1e-20
3cxw_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 2e-20
2acx_A576 Crystal Structure Of G Protein Coupled Receptor Kin 2e-20
3g51_A325 Structural Diversity Of The Active Conformation Of 2e-20
3jpv_A313 Crystal Structure Of Human Proto-Oncogene Serine Th 2e-20
3nyn_A576 Crystal Structure Of G Protein-Coupled Receptor Kin 2e-20
4dtk_A276 Novel And Selective Pan-Pim Kinase Inhibitor Length 2e-20
2j2i_B312 Crystal Structure Of The Humab Pim1 In Complex With 2e-20
2bil_B313 The Human Protein Kinase Pim1 In Complex With Its C 2e-20
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 2e-20
3c4e_A273 Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7 2e-20
1y6w_A148 Trapped Intermediate Of Calmodulin Length = 148 2e-20
3ma3_A313 Crystal Structure Of Human Proto-Oncogene Serine Th 2e-20
2bik_B313 Human Pim1 Phosphorylated On Ser261 Length = 313 2e-20
3cy3_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 2e-20
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 2e-20
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 3e-20
1yhs_A273 Crystal Structure Of Pim-1 Bound To Staurosporine L 3e-20
1qs7_A145 The 1.8 Angstrom Structure Of Calmodulin Rs20 Pepti 3e-20
4as0_A273 Cyclometalated Phthalimides As Protein Kinase Inhib 3e-20
1rfj_A149 Crystal Structure Of Potato Calmodulin Pcm6 Length 5e-20
2jfl_A325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 9e-20
2jfm_A325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 1e-19
2l1w_A149 The Solution Structure Of Soybean Calmodulin Isofor 1e-19
2j51_A325 Crystal Structure Of Human Ste20-Like Kinase Bound 1e-19
2lhi_A176 Solution Structure Of Ca2+CNA1 PEPTIDE-Bound Ycam L 1e-19
1niw_A148 Crystal Structure Of Endothelial Nitric Oxide Synth 1e-19
1ggz_A148 Crystal Structure Of The Calmodulin-Like Protein (H 1e-19
3t8o_A543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 2e-19
3c4x_A543 Crystal Structure Of G Protein Coupled Receptor Kin 2e-19
3c4w_A543 Crystal Structure Of G Protein Coupled Receptor Kin 2e-19
4aqr_A149 Crystal Structure Of A Calmodulin In Complex With T 2e-19
1xfx_O149 Crystal Structure Of Anthrax Edema Factor (Ef) In C 2e-19
3qc9_A543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 2e-19
2vd5_A412 Structure Of Human Myotonic Dystrophy Protein Kinas 2e-19
4fr4_A384 Crystal Structure Of Human SerineTHREONINE-Protein 4e-19
3ekj_A449 Calcium-Free Gcamp2 (Calcium Binding Deficient Muta 4e-19
1na7_A329 Crystal Structure Of The Catalytic Subunit Of Human 6e-19
2zmc_A390 Crystal Structure Of Human Mitotic Checkpoint Kinas 6e-19
3hmn_A342 Crystal Structure Of Human Mps1 Catalytic Domain In 6e-19
2zmd_A390 Crystal Structure Of Human Mps1 Catalytic Domain T6 7e-19
3khe_A191 Crystal Structure Of The Calcium-Loaded Calmodulin- 8e-19
1v0o_A288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 8e-19
2y8o_A362 Crystal Structure Of Human P38alpha Complexed With 9e-19
3dbq_A343 Crystal Structure Of Ttk Kinase Domain Length = 343 9e-19
1v0b_A288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 9e-19
3gcp_A360 Human P38 Map Kinase In Complex With Sb203580 Lengt 9e-19
1ove_A366 The Structure Of P38 Alpha In Complex With A Dihydr 1e-18
4exu_A371 Mapk13, Inactive Form Length = 371 1e-18
3cek_A313 Crystal Structure Of Human Dual Specificity Protein 1e-18
3h9f_A313 Crystal Structure Of Human Dual Specificity Protein 1e-18
2x9e_A317 Human Mps1 In Complex With Nms-P715 Length = 317 1e-18
1ob3_A288 Structure Of P. Falciparum Pfpk5 Length = 288 1e-18
4ds7_A147 Crystal Structure Of Yeast Calmodulin Bound To The 1e-18
3o4y_A196 Crystal Structure Of Cad Domain Of The Plasmodium V 1e-18
3coi_A353 Crystal Structure Of P38delta Kinase Length = 353 1e-18
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 1e-18
3oht_A389 Crystal Structure Of Salmo Salar P38alpha Length = 2e-18
1lkj_A146 Nmr Structure Of Apo Calmodulin From Yeast Saccharo 2e-18
3vqu_A320 Crystal Structure Of Human Mps1 Catalytic Domain In 2e-18
3fi4_A372 P38 Kinase Crystal Structure In Complex With Ro4499 2e-18
2fsl_X367 Mitogen Activated Protein Kinase P38alpha (D176a+f3 2e-18
2fso_X367 Mitogen Activated Protein Kinase P38alpha (D176a) A 2e-18
2puu_A348 Crystal Structure Of P38 Complex With 1-(5-Tert-But 2e-18
2fst_X367 Mitogen Activated Protein Kinase P38alpha (d176a+f3 2e-18
3d7z_A360 Crystal Structure Of P38 Kinase In Complex With A B 2e-18
3d83_A360 Crystal Structure Of P38 Kinase In Complex With A B 2e-18
3p4k_A370 The Third Conformation Of P38a Map Kinase Observed 2e-18
1lew_A360 Crystal Structure Of Map Kinase P38 Complexed To Th 2e-18
2oza_B366 Structure Of P38alpha Complex Length = 366 2e-18
3tg1_A380 Crystal Structure Of P38alpha In Complex With A Map 2e-18
1bmk_A379 The Complex Structure Of The Map Kinase P38SB218655 2e-18
1oz1_A372 P38 Mitogen-Activated Kinase In Complex With 4-Azai 3e-18
3mpt_A371 Crystal Structure Of P38 Kinase In Complex With A P 3e-18
2gfs_A372 P38 Kinase Crystal Structure In Complex With Ro3201 3e-18
4alu_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 3e-18
4e5a_X360 The W197a Mutant Of P38a Map Kinase Length = 360 3e-18
3oz6_A388 Crystal Structure Of Mapk From Cryptosporidium Parv 3e-18
3e92_A371 Crystal Structure Of P38 Kinase In Complex With A B 3e-18
2baq_A365 P38alpha Bound To Ro3201195 Length = 365 3e-18
3zsg_A362 X-Ray Structure Of P38alpha Bound To Tak-715 Length 3e-18
3k3j_A362 P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 3e-18
3ody_X360 Crystal Structure Of P38alpha Y323q Active Mutant L 3e-18
3od6_X360 Crystal Structure Of P38alpha Y323t Active Mutant L 3e-18
3odz_X360 Crystal Structure Of P38alpha Y323r Active Mutant L 3e-18
1di9_A360 The Structure Of P38 Mitogen-Activated Protein Kina 3e-18
3gcu_A360 Human P38 Map Kinase In Complex With Rl48 Length = 3e-18
2baj_A365 P38alpha Bound To Pyrazolourea Length = 365 3e-18
3hrb_A359 P38 Kinase Crystal Structure In Complex With Small 3e-18
2npq_A367 A Novel Lipid Binding Site In The P38 Alpha Map Kin 3e-18
1m7q_A366 Crystal Structure Of P38 Map Kinase In Complex With 3e-18
3oef_X360 Crystal Structure Of Y323f Inactive Mutant Of P38al 4e-18
3dt1_A383 P38 Complexed With A Quinazoline Inhibitor Length = 4e-18
1ian_A366 Human P38 Map Kinase Inhibitor Complex Length = 366 4e-18
2bal_A365 P38alpha Map Kinase Bound To Pyrazoloamine Length = 4e-18
2gtm_A348 Mutated Mouse P38 Map Kinase Domain In Complex With 4e-18
3nnx_A354 Crystal Structure Of Phosphorylated P38 Alpha In Co 4e-18
2uv2_A287 Crystal Structure Of Human Ste20-Like Kinase Bound 4e-18
3hvc_A362 Crystal Structure Of Human P38alpha Map Kinase Leng 4e-18
1bl6_A379 The Complex Structure Of The Map Kinase P38SB216995 4e-18
3nnu_A354 Crystal Structure Of P38 Alpha In Complex With Dp13 4e-18
3kq7_A380 Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ 4e-18
2lgc_A359 Joint Nmr And X-Ray Refinement Reveals The Structur 4e-18
1zzl_A351 Crystal Structure Of P38 With Triazolopyridine Leng 4e-18
3k3i_A350 P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 5e-18
3s3i_A349 P38 Kinase Crystal Structure In Complex With Small 5e-18
3gc9_A370 The Structure Of P38beta C119s, C162s In Complex Wi 5e-18
3hec_A348 P38 In Complex With Imatinib Length = 348 5e-18
1yw2_A360 Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 7e-18
1ywr_A360 Crystal Structure Analysis Of Inactive P38 Kinase D 8e-18
3mh2_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 8e-18
3gc8_A370 The Structure Of P38beta C162s In Complex With A Di 1e-17
3py3_A380 Crystal Structure Of Phosphorylated P38alpha Map Ki 1e-17
2f9g_A353 Crystal Structure Of Fus3 Phosphorylated On Tyr182 1e-17
4ewq_A383 Human P38 Alpha Mapk In Complex With A Pyridazine B 1e-17
2b9f_A353 Crystal Structure Of Non-Phosphorylated Fus3 Length 1e-17
2ghl_A348 Mutant Mus Musculus P38 Kinase Domain In Complex Wi 1e-17
1pme_A380 Structure Of Penta Mutant Human Erk2 Map Kinase Com 2e-17
3gi3_A360 Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana 2e-17
3o8p_A360 Conformational Plasticity Of P38 Map Kinase Dfg Mot 2e-17
2zoq_A382 Structural Dissection Of Human Mitogen-Activated Ki 3e-17
1q3d_A424 Gsk-3 Beta Complexed With Staurosporine Length = 42 3e-17
1i09_A420 Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len 3e-17
3say_A430 Crystal Structure Of Human Glycogen Synthase Kinase 3e-17
1pyx_A422 Gsk-3 Beta Complexed With Amp-Pnp Length = 422 3e-17
1q5k_A414 Crystal Structure Of Glycogen Synthase Kinase 3 In 4e-17
2b9h_A353 Crystal Structure Of Fus3 With A Docking Motif From 4e-17
3l19_A214 Crystal Structure Of Calcium Binding Domain Of Cpcd 4e-17
4acc_A465 Gsk3b In Complex With Inhibitor Length = 465 4e-17
3vum_A370 Crystal Structure Of A Cysteine-deficient Mutant M7 4e-17
3mh0_A360 Mutagenesis Of P38 Map Kinase Eshtablishes Key Role 4e-17
3gp0_A348 Crystal Structure Of Human Mitogen Activated Protei 4e-17
4h3q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 5e-17
3mh3_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 5e-17
2pk9_A317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 5e-17
1a2x_A159 Complex Of Troponin C With A 47 Residue (1-47) Frag 6e-17
3vul_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 6e-17
3krw_A688 Human Grk2 In Complex With Gbetgamma Subunits And B 6e-17
3cik_A689 Human Grk2 In Complex With Gbetagamma Subunits Leng 6e-17
4fux_A360 Crystal Structure Of The Erk2 Complexed With E75 Le 6e-17
3mh1_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 6e-17
4dit_A382 Crystal Structure Of Gsk3beta In Complex With A Imi 6e-17
2lmt_A148 Nmr Structure Of Androcam Length = 148 6e-17
1r0e_A391 Glycogen Synthase Kinase-3 Beta In Complex With 3-I 6e-17
1u5q_A348 Crystal Structure Of The Tao2 Kinase Domain: Activa 6e-17
4gsb_A364 Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 7e-17
1omw_A689 Crystal Structure Of The Complex Between G Protein- 7e-17
3psc_A695 Bovine Grk2 In Complex With Gbetagamma Subunits Len 7e-17
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 7e-17
4fv7_A360 Crystal Structure Of The Erk2 Complexed With E94 Le 7e-17
1gng_A378 Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With 7e-17
3qyw_A364 Crystal Structure Of Erk2 In Complex With An Inhibi 8e-17
3gbz_A329 Structure Of The Cmgc Cdk Kinase From Giardia Lambl 8e-17
4afj_A367 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec 8e-17
2i6l_A320 Crystal Structure Of Human Mitogen Activated Protei 8e-17
4fv6_A360 Crystal Structure Of The Erk2 Complexed With E57 Le 8e-17
2o5k_A372 Crystal Structure Of Gsk3beta In Complex With A Ben 8e-17
1bi8_A326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 8e-17
3zrk_A371 Identification Of 2-(4-Pyridyl)thienopyridinones As 9e-17
1tcf_A159 Crystal Structure Of Calcium-Saturated Rabbit Skele 9e-17
3sa0_A360 Complex Of Erk2 With Norathyriol Length = 360 9e-17
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 9e-17
2y9q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 1e-16
4erw_A306 Cdk2 In Complex With Staurosporine Length = 306 1e-16
1oit_A299 Imidazopyridines: A Potent And Selective Class Of C 1e-16
2gcd_A309 Tao2 Kinase Domain-Staurosporine Structure Length = 1e-16
1h8f_A352 Glycogen Synthase Kinase 3 Beta. Length = 352 1e-16
1wzy_A368 Crystal Structure Of Human Erk2 Complexed With A Py 1e-16
1tvo_A368 The Structure Of Erk2 In Complex With A Small Molec 1e-16
1vyw_A309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 1e-16
4eon_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 1e-16
4eom_A301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 1e-16
3o71_A358 Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length 1e-16
3r63_A358 Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 1e-16
3pxf_A306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 1e-16
1pf8_A298 Crystal Structure Of Human Cyclin-dependent Kinase 1e-16
1gz8_A299 Human Cyclin Dependent Kinase 2 Complexed With The 1e-16
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 1e-16
3pj8_A299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 1e-16
2w17_A299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 1e-16
1fin_A298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 1e-16
3zu7_A365 Crystal Structure Of A Designed Selected Ankyrin Re 1e-16
2z7l_A366 Unphosphorylated Mitogen Activated Protein Kinase E 1e-16
3c9w_A357 Crystal Structure Of Erk-2 With Hypothemycin Covale 1e-16
2fys_B364 Crystal Structure Of Erk2 Complex With Kim Peptide 1e-16
3ezr_A300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 1e-16
2ojg_A380 Crystal Structure Of Erk2 In Complex With N,n-dimet 1e-16
2ow3_A352 Glycogen Synthase Kinase-3 Beta In Complex With Bis 1e-16
3nup_A307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 1e-16
4bc6_A293 Crystal Structure Of Human Serine Threonine Kinase- 1e-16
1jow_B308 Crystal Structure Of A Complex Of Human Cdk6 And A 1e-16
3gb2_A353 Gsk3beta Inhibitor Complex Length = 353 1e-16
3qhr_A298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 2e-16
1cm8_A367 Phosphorylated Map Kinase P38-Gamma Length = 367 2e-16
4eoi_A299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 2e-16
3zdi_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 2e-16
1uv5_A350 Glycogen Synthase Kinase 3 Beta Complexed With 6-Br 2e-16
3f7z_A350 X-ray Co-crystal Structure Of Glycogen Synthase Kin 2e-16
3sd0_A350 Identification Of A Glycogen Synthase Kinase-3b Inh 2e-16
4eoj_A302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 2e-16
1ds5_A332 Dimeric Crystal Structure Of The Alpha Subunit In C 2e-16
4anm_A335 Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 2e-16
2qc6_A332 Protein Kinase Ck2 In Complex With Dbc Length = 332 2e-16
4eok_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 2e-16
4eop_A300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 2e-16
3eb0_A383 Crystal Structure Of Cgd4_240 From Cryptosporidium 2e-16
2gph_A364 Docking Motif Interactions In The Map Kinase Erk2 L 2e-16
3qrx_A169 Chlamydomonas Reinhardtii Centrin Bound To Melittin 2e-16
3pvg_A331 Crystal Structure Of Z. Mays Ck2 Alpha Subunit In C 2e-16
3tei_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 2e-16
1gol_A364 Coordinates Of Rat Map Kinase Erk2 With An Arginine 2e-16
3f88_A349 Glycogen Synthase Kinase 3beta Inhibitor Complex Le 2e-16
3vuk_A370 Crystal Structure Of A Cysteine-deficient Mutant M5 2e-16
4eoo_A299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 2e-16
1daw_A327 Crystal Structure Of A Binary Complex Of Protein Ki 2e-16
1m2p_A325 Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- Anthra 2e-16
2pvh_A352 Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]tri 2e-16
3kxg_A327 Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subun 2e-16
4dgm_A326 Crystal Structure Of Maize Ck2 In Complex With The 2e-16
4dgn_A326 Crystal Structure Of Maize Ck2 In Complex With The 2e-16
1o9u_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 2e-16
1tnw_A162 Nmr Solution Structure Of Calcium Saturated Skeleta 3e-16
4eos_A300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 4e-16
1ytz_C162 Crystal Structure Of Skeletal Muscle Troponin In Th 4e-16
1e9h_A297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 4e-16
3npc_A364 Crystal Structure Of Jnk2 Complexed With Birb796 Le 4e-16
1w98_A298 The Structural Basis Of Cdk2 Activation By Cyclin E 4e-16
2jgz_A289 Crystal Structure Of Phospho-Cdk2 In Complex With C 4e-16
4i3z_A296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 4e-16
1oir_A299 Imidazopyridines: A Potent And Selective Class Of C 5e-16
1h01_A298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 5e-16
2w49_0159 Isometrically Contracting Insect Asynchronous Fligh 5e-16
1jst_A298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 5e-16
1qmz_A299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 5e-16
2x7f_A326 Crystal Structure Of The Kinase Domain Of Human Tra 5e-16
1gii_A298 Human Cyclin Dependent Kinase 2 Complexed With The 5e-16
1ogu_A302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 5e-16
4tnc_A162 Refined Structure Of Chicken Skeletal Muscle Tropon 5e-16
4eoq_A301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 5e-16
4bcq_A301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 5e-16
3bht_A300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 5e-16
1h1p_A303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 5e-16
3zuv_A364 Crystal Structure Of A Designed Selected Ankyrin Re 6e-16
2erk_A365 Phosphorylated Map Kinase Erk2 Length = 365 6e-16
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 6e-16
5tnc_A162 Refined Crystal Structure Of Troponin C From Turkey 7e-16
2iw6_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 7e-16
3vui_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 8e-16
3vuh_A370 Crystal Structure Of A Cysteine-deficient Mutant M3 8e-16
3e7o_A360 Crystal Structure Of Jnk2 Length = 360 9e-16
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 1e-15
3vug_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 1e-15
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 1e-15
2iw8_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 1e-15
3sls_A304 Crystal Structure Of Human Mek-1 Kinase In Complex 2e-15
3vud_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 2e-15
3u87_A349 Structure Of A Chimeric Construct Of Human Ck2alpha 2e-15
2xrw_A371 Linear Binding Motifs For Jnk And For Calcineurin A 2e-15
1ukh_A369 Structural Basis For The Selective Inhibition Of Jn 2e-15
1ua2_A346 Crystal Structure Of Human Cdk7 Length = 346 3e-15
3v3v_A379 Structural And Functional Analysis Of Quercetagetin 4e-15
2xs0_A386 Linear Binding Motifs For Jnk And For Calcineurin A 5e-15
3juh_A335 Crystal Structure Of A Mutant Of Human Protein Kina 5e-15
4ec8_A373 Structure Of Full Length Cdk9 In Complex With Cycli 6e-15
1h4l_A292 Structure And Regulation Of The Cdk5-P25(Nck5a) Com 6e-15
3ofm_A350 Structure Of A Human Ck2alpha Prime, The Paralog Is 6e-15
4bcf_A331 Structure Of Cdk9 In Complex With Cyclin T And A 2- 6e-15
3ttj_A464 Crystal Structure Of Jnk3 Complexed With Cc-359, A 7e-15
1ung_A292 Structural Mechanism For The Inhibition Of Cdk5-P25 7e-15
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 8e-15
3q9w_A336 Crystal Structure Of Human Ck2 Alpha In Complex Wit 8e-15
2r7i_A335 Crystal Structure Of Catalytic Subunit Of Protein K 8e-15
3nga_A333 Human Ck2 Catalytic Domain In Complex With Cx-4945 9e-15
4dgl_C335 Crystal Structure Of The Ck2 Tetrameric Holoenzyme 9e-15
3fi3_A364 Crystal Structure Of Jnk3 With Indazole Inhibitor, 9e-15
1jwh_A337 Crystal Structure Of Human Protein Kinase Ck2 Holoe 9e-15
3h30_A334 Crystal Structure Of The Catalytic Subunit Of Human 9e-15
3bqc_A335 High Ph-Value Crystal Structure Of Emodin In Comple 9e-15
3fv8_A355 Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le 9e-15
1pjk_A334 Crystal Structure Of A C-terminal Deletion Mutant O 9e-15
2zjw_A340 Crystal Structure Of Human Ck2 Alpha Complexed With 1e-14
3elj_A369 Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine 1e-14
1jnk_A423 The C-Jun N-Terminal Kinase (Jnk3s) Complexed With 1e-14
3mi9_A351 Crystal Structure Of Hiv-1 Tat Complexed With Human 1e-14
3kvx_A364 Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le 1e-14
3blh_A331 Crystal Structure Of Human Cdk9CYCLINT1 Length = 33 1e-14
3mb6_A331 Human Ck2 Catalytic Domain In Complex With A Difura 1e-14
3nsz_A330 Human Ck2 Catalytic Domain In Complex With Amppn Le 1e-14
2ok1_A365 Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 1e-14
1pmn_A364 Crystal Structure Of Jnk3 In Complex With An Imidaz 1e-14
3ptg_A363 Design And Synthesis Of A Novel, Orally Efficacious 1e-14
3q04_A328 Crystal Structure Of The Apo-Form Of Human Ck2 Alph 1e-14
3oxi_A362 Design And Synthesis Of Disubstituted Thiophene And 1e-14
3pze_A358 Jnk1 In Complex With Inhibitor Length = 358 1e-14
2o0u_A364 Crystal Structure Of Human Jnk3 Complexed With N-{3 1e-14
2r9s_A356 C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu 1e-14
4an2_A301 Crystal Structures Of Human Mek1 With Carboxamide-B 1e-14
4h36_A356 Crystal Structure Of Jnk3 In Complex With Atf2 Pept 2e-14
2b1p_A355 Inhibitor Complex Of Jnk3 Length = 355 2e-14
2exc_X356 Inhibitor Complex Of Jnk3 Length = 356 2e-14
3fi2_A353 Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib 2e-14
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 2e-14
3rzf_A 677 Crystal Structure Of Inhibitor Of Kappab Kinase Bet 2e-14
3qa8_A 676 Crystal Structure Of Inhibitor Of Kappa B Kinase Be 2e-14
3f61_A311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 2e-14
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 2e-14
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 2e-14
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 2e-14
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 2e-14
3e3b_X339 Crystal Structure Of Catalytic Subunit Of Human Pro 2e-14
2lhh_A128 Solution Structure Of Ca2+-Bound Ycam Length = 128 3e-14
2lhh_A128 Solution Structure Of Ca2+-Bound Ycam Length = 128 7e-05
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 3e-14
3kf9_A149 Crystal Structure Of The SdcenSKMLCK COMPLEX Length 3e-14
3ori_A311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 3e-14
1mru_A311 Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob 4e-14
2lan_A167 Nmr Structure Of Ca2+-Bound Cabp1 N-Domain With Rdc 4e-14
3orn_A307 Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In 5e-14
3f69_A311 Crystal Structure Of The Mycobacterium Tuberculosis 5e-14
3ox5_A153 Crystal Structure Of The Calcium Sensor Calcium-Bin 6e-14
3o17_A370 Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 6e-14
3ox6_A153 Crystal Structure Of The Calcium Sensor Calcium-Bin 7e-14
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 8e-14
1z57_A339 Crystal Structure Of Human Clk1 In Complex With 10z 8e-14
1o6y_A299 Catalytic Domain Of Pknb Kinase From Mycobacterium 8e-14
2g01_A370 Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit 9e-14
3kvw_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 1e-13
4azf_A417 Human Dyrk2 In Complex With Leucettine L41 Length = 1e-13
3a7f_A303 Human Mst3 Kinase Length = 303 2e-13
2obh_A143 Centrin-Xpc Peptide Length = 143 2e-13
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 2e-13
3g33_A308 Crystal Structure Of Cdk4CYCLIN D3 Length = 308 2e-13
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 2e-13
2vag_A339 Crystal Structure Of Di-Phosphorylated Human Clk1 I 3e-13
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 3e-13
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 3e-13
2w99_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 3e-13
3mtl_A324 Crystal Structure Of The Pctaire1 Kinase In Complex 3e-13
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 4e-13
3p23_A432 Crystal Structure Of The Human Kinase And Rnase Dom 5e-13
2w96_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 5e-13
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 5e-13
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 5e-13
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 5e-13
2w9f_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 6e-13
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 6e-13
2y4i_C395 Ksr2-Mek1 Heterodimer Length = 395 6e-13
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 7e-13
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 7e-13
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 7e-13
4euu_A319 Structure Of Bx-795 Complexed With Human Tbk1 Kinas 7e-13
3k2l_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 7e-13
4h58_A275 Braf In Complex With Compound 3 Length = 275 8e-13
4eut_A396 Structure Of Bx-795 Complexed With Unphosphorylated 8e-13
3vn9_A340 Rifined Crystal Structure Of Non-Phosphorylated Map 8e-13
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 1e-12
3fwb_A161 Sac3:sus1:cdc31 Complex Length = 161 1e-12
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 1e-12
1zy4_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 1e-12
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 1e-12
3eqc_A360 X-Ray Structure Of The Human Mitogen-Activated Prot 1e-12
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 2e-12
2wu6_A381 Crystal Structure Of The Human Clk3 In Complex With 2e-12
3bea_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 4e-12
2exe_A357 Crystal Structure Of The Phosphorylated Clk3 Length 4e-12
2i1m_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 5e-12
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 5e-12
1la0_A161 Solution Structure Of Calcium Saturated Cardiac Tro 5e-12
4aw5_A291 Complex Of The Ephb4 Kinase Domain With An Oxindole 6e-12
2eu9_A355 Crystal Structure Of Clk3 Length = 355 6e-12
1s9j_A341 X-Ray Structure Of The Human Mitogen-Activated Prot 7e-12
2p55_A333 X-Ray Structure Of The Human Mitogen-Activated Prot 7e-12
3mbl_A328 Crystal Structure Of The Human Mitogen-Activated Pr 8e-12
3dv3_A322 Mek1 With Pf-04622664 Bound Length = 322 8e-12
1how_A373 The X-Ray Crystal Structure Of Sky1p, An Sr Protein 8e-12
1q8y_A373 The Structure Of The Yeast Sr Protein Kinase, Sky1p 9e-12
1aj4_A161 Structure Of Calcium-Saturated Cardiac Troponin C, 9e-12
1zyc_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 9e-12
2jt0_A161 Solution Structure Of F104w Cardiac Troponin C Leng 9e-12
2jt3_A161 Solution Structure Of F153w Cardiac Troponin C Leng 9e-12
3nr9_A368 Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length 1e-11
1dtl_A161 Crystal Structure Of Calcium-Saturated (3ca2+) Card 1e-11
4ic7_A442 Crystal Structure Of The Erk5 Kinase Domain In Comp 1e-11
4b99_A398 Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le 1e-11
3fme_A290 Crystal Structure Of Human Mitogen-Activated Protei 2e-11
2bl0_C142 Physarum Polycephalum Myosin Ii Regulatory Domain L 2e-11
2a19_B284 Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Leng 2e-11
3uiu_A306 Crystal Structure Of Apo-Pkr Kinase Domain Length = 2e-11
2ogv_A317 Crystal Structure Of The Autoinhibited Human C-Fms 2e-11
3lcd_A329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 2e-11
2gv5_A161 Crystal Structure Of Sfi1pCDC31P COMPLEX Length = 1 2e-11
2in6_A287 Wee1 Kinase Complex With Inhibitor Pd311839 Length 2e-11
2pml_X348 Crystal Structure Of Pfpk7 In Complex With An Atp A 2e-11
4g31_A299 Crystal Structure Of Gsk6414 Bound To Perk (R587-R1 2e-11
2i0v_A335 C-Fms Tyrosine Kinase In Complex With A Quinolone I 3e-11
2jtz_A161 Solution Structure And Chemical Shift Assignments O 3e-11
2jt8_A161 Solution Structure Of The F153-To-5-Flurotryptophan 3e-11
2vwu_A302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 3e-11
2z2w_A285 Humand Wee1 Kinase Complexed With Inhibitor Pf03357 3e-11
3bi6_A287 Wee1 Kinase Complex With Inhibitor Pd352396 Length 3e-11
1x8b_A289 Structure Of Human Wee1a Kinase: Kinase Domain Comp 3e-11
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 3e-11
3dk3_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 8e-11
4e4m_A302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 1e-10
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 1e-10
1zxe_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 1e-10
2f4j_A287 Structure Of The Kinase Domain Of An Imatinib-Resis 1e-10
3n9x_A432 Crystal Structure Of Map Kinase From Plasmodium Ber 1e-10
2rei_A318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 2e-10
3anq_A368 Human Dyrk1aINHIBITOR COMPLEX Length = 368 2e-10
2z60_A288 Crystal Structure Of The T315i Mutant Of Abl Kinase 2e-10
2vx3_A382 Crystal Structure Of The Human Dual Specificity Tyr 2e-10
3oy3_A284 Crystal Structure Of Abl T315i Mutant Kinase Domain 2e-10
2g2f_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 2e-10
4e6d_A298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 2e-10
2r2p_A295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 2e-10
1fpu_A293 Crystal Structure Of Abl Kinase Domain In Complex W 2e-10
2nry_A307 Crystal Structure Of Irak-4 Length = 307 2e-10
2e2b_A293 Crystal Structure Of The C-Abl Kinase Domain In Com 2e-10
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 2e-10
2qoh_A288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 2e-10
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 2e-10
2hiw_A287 Crystal Structure Of Inactive Conformation Abl Kina 2e-10
3pyy_A298 Discovery And Characterization Of A Cell-Permeable, 2e-10
2g1t_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 2e-10
3e62_A293 Fragment Based Discovery Of Jak-2 Inhibitors Length 3e-10
3dk6_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 3e-10
3q32_A301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 3e-10
3rvg_A303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 3e-10
3tjc_A298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 3e-10
3lpb_A295 Crystal Structure Of Jak2 Complexed With A Potent 2 3e-10
2b7a_A293 The Structural Basis Of Janus Kinase 2 Inhibition B 3e-10
3oxz_A284 Crystal Structure Of Abl Kinase Domain Bound With A 3e-10
4hge_A300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 3e-10
2w1i_A326 Structure Determination Of Aurora Kinase In Complex 3e-10
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 3e-10
4aqc_A301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 3e-10
3enm_A316 The Structure Of The Map2k Mek6 Reveals An Autoinhi 3e-10
2nru_A307 Crystal Structure Of Irak-4 Length = 307 4e-10
3jy9_A311 Janus Kinase 2 Inhibitors Length = 311 4e-10
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 4e-10
3ugc_A295 Structural Basis Of Jak2 Inhibition By The Type Ii 4e-10
2ggm_A172 Human Centrin 2 Xeroderma Pigmentosum Group C Prote 4e-10
4aze_A382 Human Dyrk1a In Complex With Leucettine L41 Length 4e-10
3lco_A324 Inhibitor Bound To A Dfg-Out Structure Of The Kinas 4e-10
3io7_A313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 4e-10
2oib_A301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 4e-10
4dn5_A356 Crystal Structure Of Nf-kb-inducing Kinase (nik) Le 4e-10
4e4l_A302 Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 5e-10
2jnf_A158 Solution Structure Of Fly Troponin C, Isoform F1 Le 5e-10
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 5e-10
2v7a_A286 Crystal Structure Of The T315i Abl Mutant In Comple 5e-10
3sdj_A448 Structure Of Rnase-Inactive Point Mutant Of Oligome 5e-10
3eyg_A290 Crystal Structures Of Jak1 And Jak2 Inhibitor Compl 6e-10
2pzp_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 6e-10
3fbv_A448 Crystal Structure Of The Oligomer Formed By The Kin 6e-10
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 7e-10
3e3r_A204 Crystal Structure And Biochemical Characterization 8e-10
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 8e-10
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 8e-10
2xa4_A298 Inhibitors Of Jak2 Kinase Domain Length = 298 9e-10
2pvy_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 9e-10
3rp9_A458 Crystal Structure Of The Apo Mapk From Toxoplasma G 9e-10
1jpa_A312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 9e-10
1u59_A287 Crystal Structure Of The Zap-70 Kinase Domain In Co 1e-09
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 1e-09
3ll6_A337 Crystal Structure Of The Human Cyclin G Associated 1e-09
2pz5_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-09
1mf8_B170 Crystal Structure Of Human Calcineurin Complexed Wi 1e-09
1tco_B169 Ternary Complex Of A Calcineurin A Fragment, Calcin 1e-09
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 1e-09
2p6b_B156 Crystal Structure Of Human Calcineurin In Complex W 1e-09
3c4f_A302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 1e-09
3rhx_B306 Crystal Structure Of The Catalytic Domain Of Fgfr1 1e-09
4f63_A309 Crystal Structure Of Human Fibroblast Growth Factor 2e-09
3ll8_B155 Crystal Structure Of Calcineurin In Complex With Ak 2e-09
3gql_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 2e-09
3p1a_A311 Structure Of Human Membrane-Associated Tyrosine- An 2e-09
3gen_A283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 2e-09
3js2_A317 Crystal Structure Of Minimal Kinase Domain Of Fibro 2e-09
3kxx_A317 Structure Of The Mutant Fibroblast Growth Factor Re 2e-09
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 2e-09
3p08_A267 Crystal Structure Of The Human Btk Kinase Domain Le 2e-09
1fgk_A310 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-09
2dyl_A318 Crystal Structure Of Human Mitogen-Activated Protei 2e-09
2pwl_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-09
1k2p_A263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 2e-09
4bbe_A298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 2e-09
3aln_A327 Crystal Structure Of Human Non-Phosphorylated Mkk4 2e-09
4g3d_A371 Crystal Structure Of Human Nf-kappab Inducing Kinas 2e-09
3tt0_A382 Co-Structure Of Fibroblast Growth Factor Receptor 1 2e-09
2psq_A370 Crystal Structure Of Unphosphorylated Unactivated W 2e-09
3ocs_A271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 2e-09
3pix_A274 Crystal Structure Of Btk Kinase Domain Complexed Wi 3e-09
4f99_A361 Human Cdc7 Kinase In Complex With Dbf4 And Nucleoti 3e-09
2jkm_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 3e-09
4gs6_A315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 3e-09
1gjo_A316 The Fgfr2 Tyrosine Kinase Domain Length = 316 3e-09
2etm_A281 Crystal Structure Of Focal Adhesion Kinase Domain C 3e-09
1s9i_A354 X-Ray Structure Of The Human Mitogen-Activated Prot 3e-09
3b2t_A311 Structure Of Phosphotransferase Length = 311 3e-09
1mp8_A281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 3e-09
3bz3_A276 Crystal Structure Analysis Of Focal Adhesion Kinase 3e-09
3pxk_A282 Focal Adhesion Kinase Catalytic Domain In Complex W 3e-09
2ozo_A613 Autoinhibited Intact Human Zap-70 Length = 613 3e-09
2eva_A307 Structural Basis For The Interaction Of Tak1 Kinase 3e-09
4ebw_A304 Structure Of Focal Adhesion Kinase Catalytic Domain 3e-09
2j0m_B276 Crystal Structure A Two-Chain Complex Between The F 3e-09
3lj0_A434 Ire1 Complexed With Adp And Quercetin Length = 434 3e-09
2pzr_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 3e-09
3ri1_A313 Crystal Structure Of The Catalytic Domain Of Fgfr2 3e-09
2j0j_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 4e-09
2rio_A434 Structure Of The Dual Enzyme Ire1 Reveals The Basis 4e-09
2pvf_A334 Crystal Structure Of Tyrosine Phosphorylated Activa 5e-09
2qon_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 6e-09
3gqi_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 6e-09
3rgf_A405 Crystal Structure Of Human Cdk8CYCC Length = 405 6e-09
2hen_A286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 6e-09
3cly_A334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 6e-09
2qob_A344 Human Epha3 Kinase Domain, Base Structure Length = 6e-09
2qoo_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 7e-09
2qoc_A344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 7e-09
3dzq_A361 Human Epha3 Kinase Domain In Complex With Inhibitor 7e-09
2qoi_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 7e-09
3fxx_A371 Human Epha3 Kinase And Juxtamembrane Region Bound T 8e-09
2qof_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 8e-09
2qod_A373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 8e-09
2gsf_A373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 8e-09
2qo7_A373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 8e-09
1zot_B69 Crystal Structure Analysis Of The CyaaC-Cam With Pm 8e-09
1rjb_A344 Crystal Structure Of Flt3 Length = 344 8e-09
2jkk_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 8e-09
2q0b_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 9e-09
2j0k_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 9e-09
2hel_A306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 9e-09
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 9e-09
2y6m_A291 Crystal Structure Of Epha4 Kinase Domain Length = 2 1e-08
3k54_A283 Structures Of Human Bruton's Tyrosine Kinase In Act 1e-08
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 1e-08
1f71_A67 Refined Solution Structure Of Calmodulin C-Terminal 1e-08
2j0l_A276 Crystal Structure Of A The Active Conformation Of T 1e-08
1yru_B74 Crystal Structure Analysis Of The Adenylyl Cyclaes 1e-08
4g3g_A350 Crystal Structure Of Murine Nf-kappab Inducing Kina 1e-08
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 1e-08
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 1e-08
1cmf_A73 Nmr Solution Structure Of Apo Calmodulin Carboxy-Te 1e-08
2py3_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-08
3oct_A265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 1e-08
2oh4_A316 Crystal Structure Of Vegfr2 With A Benzimidazole-Ur 1e-08
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 1e-08
2xyu_A285 Crystal Structure Of Epha4 Kinase Domain In Complex 1e-08
3qup_A323 Inhibitor Bound Structure Of The Kinase Domain Of T 2e-08
2qok_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-08
1fw4_A71 Crystal Structure Of E. Coli Fragment Tr2c From Cal 2e-08
1f70_A76 Refined Solution Structure Of Calmodulin N-Terminal 2e-08
1f70_A76 Refined Solution Structure Of Calmodulin N-Terminal 9e-07
3b32_A75 Crystal Structure Of Calcium-Saturated Calmodulin N 2e-08
3b32_A75 Crystal Structure Of Calcium-Saturated Calmodulin N 1e-06
1ak8_A76 Nmr Solution Structure Of Cerium-Loaded Calmodulin 2e-08
1ak8_A76 Nmr Solution Structure Of Cerium-Loaded Calmodulin 1e-06
2col_B67 Crystal Structure Analysis Of CyaaC-Cam With Pyroph 2e-08
4f0f_A287 Crystal Structure Of The Roco4 Kinase Domain Bound 2e-08
3s95_A310 Crystal Structure Of The Human Limk1 Kinase Domain 2e-08
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 2e-08
2o8y_A298 Apo Irak4 Kinase Domain Length = 298 2e-08
3uct_A79 Structure Of Mn2+-Bound N-Terminal Domain Of Calmod 2e-08
3uct_A79 Structure Of Mn2+-Bound N-Terminal Domain Of Calmod 1e-06
3bkb_A377 Crystal Structure Of Human Feline Sarcoma Viral Onc 2e-08
4g3f_A336 Crystal Structure Of Murine Nf-kappab Inducing Kina 2e-08
1vr2_A316 Human Vascular Endothelial Growth Factor Receptor 2 2e-08
2xir_A316 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-08
2qol_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 3e-08
3nie_A429 Crystal Structure Of Pf11_0147 Length = 429 3e-08
4agc_A353 Crystal Structure Of Vegfr2 (Juxtamembrane And Kina 3e-08
4g3c_A352 Crystal Structure Of Apo Murine Nf-kappab Inducing 3e-08
4hzs_A341 Crystal Structure Of Ack1 Kinase Domain With C-term 3e-08
3cd3_A377 Crystal Structure Of Phosphorylated Human Feline Sa 3e-08
3kul_A325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 4e-08
1u54_A291 Crystal Structures Of The Phosphorylated And Unphos 4e-08
1f54_A77 Solution Structure Of The Apo N-Terminal Domain Of 4e-08
1f54_A77 Solution Structure Of The Apo N-Terminal Domain Of 7e-05
3vnt_A318 Crystal Structure Of The Kinase Domain Of Human Veg 4e-08
2bl0_B145 Physarum Polycephalum Myosin Ii Regulatory Domain L 4e-08
4ewh_B275 Co-Crystal Structure Of Ack1 With Inhibitor Length 4e-08
2lqc_A77 Nmr Solution Structure Of A Ca2+-Calmodulin With A 4e-08
2lqc_A77 Nmr Solution Structure Of A Ca2+-Calmodulin With A 7e-07
2i08_A78 Solvation Effect In Conformational Changes Of Ef-Ha 4e-08
2i08_A78 Solvation Effect In Conformational Changes Of Ef-Ha 4e-07
1u46_A291 Crystal Structure Of The Unphosphorylated Kinase Do 4e-08
3ewh_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 4e-08
3u6j_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 4e-08
2llo_A80 Solution Nmr-Derived Structure Of Calmodulin N-Lobe 5e-08
2llo_A80 Solution Nmr-Derived Structure Of Calmodulin N-Lobe 1e-06
3eqp_B276 Crystal Structure Of Ack1 With Compound T95 Length 5e-08
4hzr_A277 Crystal Structure Of Ack1 Kinase Domain Length = 27 5e-08
2rrt_A72 Solution Structure Of Magnesium-Bound Form Of Calmo 5e-08
1j7o_A76 Solution Structure Of Calcium-calmodulin N-terminal 5e-08
1j7o_A76 Solution Structure Of Calcium-calmodulin N-terminal 9e-07
4id7_A273 Ack1 Kinase In Complex With The Inhibitor Cis-3-[8- 5e-08
2kn2_A92 Solution Structure Of The C-Terminal Domain Of Soyb 5e-08
3ifk_A90 Crystal Structure Of Calcium-Saturated Calmodulin N 5e-08
3ifk_A90 Crystal Structure Of Calcium-Saturated Calmodulin N 1e-06
2kxw_A73 Structure Of The C-Domain Fragment Of Apo Calmoduli 6e-08
1sw8_A79 Solution Structure Of The N-Terminal Domain Of Huma 6e-08
1sw8_A79 Solution Structure Of The N-Terminal Domain Of Huma 3e-07
1ywn_A316 Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p 6e-08
2rob_A70 Solution Structure Of Calcium Bound Soybean Calmodu 6e-08
1bjf_A193 Crystal Structure Of Recombinant Bovine Neurocalcin 7e-08
2p0c_A313 Catalytic Domain Of The Proto-Oncogene Tyrosine-Pro 7e-08
3cjf_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 7e-08
4f1o_A287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 7e-08
2ro8_A79 Solution Structure Of Calcium Bound Soybean Calmodu 8e-08
2ro8_A79 Solution Structure Of Calcium Bound Soybean Calmodu 4e-06
4f1m_A287 Crystal Structure Of The G1179s Roco4 Kinase Domain 8e-08
2p2i_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 8e-08
3cjg_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 1e-07
3llt_A360 Crystal Structure Of Pf14_0431, Kinase Domain Lengt 1e-07
3qd2_B332 Crsytal Structure Of Mouse Perk Kinase Domain Lengt 1e-07
2p2h_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 1e-07
3kul_B325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 1e-07
3uys_A296 Crystal Structure Of Apo Human Ck1d Length = 296 1e-07
1yvj_A290 Crystal Structure Of The Jak3 Kinase Domain In Comp 1e-07
1ckj_A317 Casein Kinase I Delta Truncation Mutant Containing 2e-07
2b1u_A71 Solution Structure Of Calmodulin-Like Skin Protein 2e-07
4hvd_A314 Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h 2e-07
3lxn_A318 Structural And Thermodynamic Characterization Of Th 2e-07
3aaj_A167 Crystal Structure Of Ca2+-Bound Form Of Des3-23alg- 2e-07
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure

Iteration: 1

Score = 312 bits (799), Expect = 4e-85, Method: Compositional matrix adjust. Identities = 181/469 (38%), Positives = 261/469 (55%), Gaps = 29/469 (6%) Query: 183 GHLKEYYNLGRKLGNGQFGTTFLCMEKGTGKEYACKSIAKRKLIQKEDVEDVRREIQIMH 242 G E YN+ LG G FG C ++ T +EYA K I K + +D + RE++++ Sbjct: 18 GTFAERYNIVCMLGKGSFGEVLKCKDRITQQEYAVKVINKAS-AKNKDTSTILREVELLK 76 Query: 243 HLAGHANAVLIKGAYEDSVAVHVVMELCAGGELFDRIIKKGHYTERKAAQLARTIVGFVE 302 L H N + + EDS + ++V EL GGELFD IIK+ ++E AA++ + + + Sbjct: 77 KL-DHPNIMKLFEILEDSSSFYIVGELYTGGELFDEIIKRKRFSEHDAARIIKQVFSGIT 135 Query: 303 TSHSLGVMHRDLKPENFLFVNEHEDSPLKAIDFGLSTFFKPGDIFTDVVGSPYYVSPEVL 362 H ++HRDLKPEN L ++ +D +K IDFGLST F+ D +G+ YY++PEVL Sbjct: 136 YMHKHNIVHRDLKPENILLESKEKDCDIKIIDFGLSTCFQQNTKMKDRIGTAYYIAPEVL 195 Query: 363 LKHYGPEADVWSAGVIIYILLSGVPPFWGETEHDIFEEVLHGDLDLSSDPWPKISENAKD 422 Y + DVWSAGVI+YILLSG PPF+G+ E+DI + V G W IS++AKD Sbjct: 196 RGTYDEKCDVWSAGVILYILLSGTPPFYGKNEYDILKRVETGKYAFDLPQWRTISDDAKD 255 Query: 423 LVRKMLVRDPRKRLTAHEVLCHPWFQ-IDGGAP---DKPLDSAVLSRLKQFSAMNKLKKM 478 L+RKML P R+TA + L HPW Q P D P + ++ ++QF A KL + Sbjct: 256 LIRKMLTFHPSLRITATQCLEHPWIQKYSSETPTISDLPSLESAMTNIRQFQAEKKLAQA 315 Query: 479 ALRVIAESLSE-EEIAGLKEMFKALDADNSGFITFEELKVGLKRF--------------- 522 AL +A L+ +E L E+F+ LD +N G + +EL G F Sbjct: 316 ALLYMASKLTTLDETKQLTEIFRKLDTNNDGMLDRDELVRGYHEFMRLKGVDSNSLIQNE 375 Query: 523 GASLDESEIYDLMQAADVDNSGTIDYGEFIAATLHLNKAQREDHLFAAFSYFDKDGSGYI 582 G+++ E +I LM D+D SG+I+Y EFIA+ + + + AF FDKDGSG I Sbjct: 376 GSTI-EDQIDSLMPLLDMDGSGSIEYSEFIASAIDRTILLSRERMERAFKMFDKDGSGKI 434 Query: 583 TADEL----QQACDEFGIEDMRLEDLIREVDQDNDGRIDYNEFVAMMHN 627 + EL QA +E+ LE +I +VD + DG +D+NEFV M+ N Sbjct: 435 STKELFKLFSQADSSIQMEE--LESIIEQVDNNKDGEVDFNEFVEMLQN 481
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|2AAO|A Chain A, Regulatory Apparatus Of Calcium Dependent Protein Kinase From Arabidopsis Thaliana Length = 166 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|1S6I|A Chain A, Ca2+-Regulatory Region (Cld) From Soybean Calcium-Dependent Protein Kinase-Alpha (Cdpk) In The Presence Of Ca2+ And The Junction Domain (Jd) Length = 188 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|3R1N|A Chain A, Mk3 Kinase Bound To Compound 5b Length = 317 Back     alignment and structure
>pdb|3FHR|A Chain A, High Resolution Crystal Structure Of Mitogen-Activated Protein Kinase-Activated Protein Kinase 3 (Mk3)-Inhibitor Complex Length = 336 Back     alignment and structure
>pdb|2OZA|A Chain A, Structure Of P38alpha Complex Length = 356 Back     alignment and structure
>pdb|1KWP|A Chain A, Crystal Structure Of Mapkap2 Length = 400 Back     alignment and structure
>pdb|2ONL|C Chain C, Crystal Structure Of The P38a-Mapkap Kinase 2 Heterodimer Length = 406 Back     alignment and structure
>pdb|3KA0|A Chain A, Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4-Ylamino)-2- Hydroxyphenyl)-N-Methylbenzo[b]thiophene-2-Carboxamide Length = 320 Back     alignment and structure
>pdb|3FPM|A Chain A, Crystal Structure Of A Squarate Inhibitor Bound To Mapkap Kinase-2 Length = 325 Back     alignment and structure
>pdb|2PZY|A Chain A, Structure Of Mk2 Complexed With Compound 76 Length = 324 Back     alignment and structure
>pdb|3R2B|A Chain A, Mk2 Kinase Bound To Compound 5b Length = 318 Back     alignment and structure
>pdb|2JBO|A Chain A, Protein Kinase Mk2 In Complex With An Inhibitor (Crystal Form-1, Soaking) Length = 326 Back     alignment and structure
>pdb|2P3G|X Chain X, Crystal Structure Of A Pyrrolopyridine Inhibitor Bound To Mapkap Kinase-2 Length = 327 Back     alignment and structure
>pdb|3R2Y|A Chain A, Mk2 Kinase Bound To Compound 1 Length = 319 Back     alignment and structure
>pdb|3GOK|A Chain A, Binding Site Mapping Of Protein Ligands Length = 334 Back     alignment and structure
>pdb|2AC5|A Chain A, Structure Of Human Mnk2 Kinase Domain Mutant D228g Length = 316 Back     alignment and structure
>pdb|2AC3|A Chain A, Structure Of Human Mnk2 Kinase Domain Length = 316 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|1NXK|A Chain A, Crystal Structure Of Staurosporine Bound To Map Kap Kinase 2 Length = 400 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|1TKI|A Chain A, Autoinhibited Serine Kinase Domain Of The Giant Muscle Protein Titin Length = 321 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|3KGA|A Chain A, Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexed With A Potent 3-Aminopyrazole Atp Site Inhibitor Length = 299 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|3PM8|A Chain A, Cad Domain Of Pff0520w, Calcium Dependent Protein Kinase Length = 197 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|1S6J|A Chain A, N-Terminal Region Of The Ca2+-Saturated Calcium Regulatory Domain (Cld) From Soybean Calcium-Dependent Protein Kinase- Alpha (Cdpk) Length = 87 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 Back     alignment and structure
>pdb|3E3P|A Chain A, Glycogen Synthase Kinase From Leishmania Major Length = 360 Back     alignment and structure
>pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 Back     alignment and structure
>pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|3U0K|A Chain A, Crystal Structure Of The Genetically Encoded Calcium Indicator Rcamp Length = 440 Back     alignment and structure
>pdb|3SG6|A Chain A, Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) Length = 450 Back     alignment and structure
>pdb|3EVU|A Chain A, Crystal Structure Of Calcium Bound Dimeric Gcamp2, (#1) Length = 449 Back     alignment and structure
>pdb|3EK8|A Chain A, Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|3EKH|A Chain A, Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|3SG5|A Chain A, Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linker 1), Lp(Linker 2) Length = 448 Back     alignment and structure
>pdb|3O78|A Chain A, The Structure Of Ca2+ Sensor (Case-12) Length = 415 Back     alignment and structure
>pdb|3O77|A Chain A, The Structure Of Ca2+ Sensor (Case-16) Length = 415 Back     alignment and structure
>pdb|2F2O|A Chain A, Structure Of Calmodulin Bound To A Calcineurin Peptide: A New Way Of Making An Old Binding Mode Length = 179 Back     alignment and structure
>pdb|3SG2|A Chain A, Crystal Structure Of Gcamp2-T116v,D381y Length = 449 Back     alignment and structure
>pdb|3EVR|A Chain A, Crystal Structure Of Calcium Bound Monomeric Gcamp2 Length = 411 Back     alignment and structure
>pdb|3SG4|A Chain A, Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Length = 448 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|3SG7|A Chain A, Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 448 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|3SG3|A Chain A, Crystal Structure Of Gcamp3-D380y Length = 449 Back     alignment and structure
>pdb|3DLS|A Chain A, Crystal Structure Of Human Pas Kinase Bound To Adp Length = 335 Back     alignment and structure
>pdb|4DJC|A Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCAM COMPLEX Length = 152 Back     alignment and structure
>pdb|4E7W|A Chain A, Structure Of Gsk3 From Ustilago Maydis Length = 394 Back     alignment and structure
>pdb|1IQ5|A Chain A, CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE KINASE Fragment Length = 149 Back     alignment and structure
>pdb|2WEL|D Chain D, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 150 Back     alignment and structure
>pdb|2YGG|B Chain B, Complex Of Cambr And Cam Length = 150 Back     alignment and structure
>pdb|2BE6|A Chain A, 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaCAM COMPLEX Length = 150 Back     alignment and structure
>pdb|1EXR|A Chain A, The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Calmodulin Length = 148 Back     alignment and structure
>pdb|1XFU|O Chain O, Crystal Structure Of Anthrax Edema Factor (ef) Truncation Mutant, Ef-delta 64 In Complex With Calmodulin Length = 149 Back     alignment and structure
>pdb|3EWT|A Chain A, Crystal Structure Of Calmodulin Complexed With A Peptide Length = 154 Back     alignment and structure
>pdb|1CM1|A Chain A, Motions Of Calmodulin-Single-Conformer Refinement Length = 148 Back     alignment and structure
>pdb|1PRW|A Chain A, Crystal Structure Of Bovine Brain Ca++ Calmodulin In A Compact Form Length = 149 Back     alignment and structure
>pdb|1UP5|B Chain B, Chicken Calmodulin Length = 148 Back     alignment and structure
>pdb|1CDL|A Chain A, Target Enzyme Recognition By Calmodulin: 2.4 Angstroms Structure Of A Calmodulin-Peptide Complex Length = 147 Back     alignment and structure
>pdb|1OOJ|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Calmodulin Length = 149 Back     alignment and structure
>pdb|2BKH|B Chain B, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 149 Back     alignment and structure
>pdb|2K0J|A Chain A, Solution Structure Of Cam Complexed To Drp1p Length = 148 Back     alignment and structure
>pdb|2VB6|B Chain B, Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigor State ( Crystal Form 2) Length = 149 Back     alignment and structure
>pdb|2BBM|A Chain A, Solution Structure Of A Calmodulin-Target Peptide Complex By Multidimensional Nmr Length = 148 Back     alignment and structure
>pdb|2LV6|A Chain A, The Complex Between Ca-calmodulin And Skeletal Muscle Myosin Light Chain Kinase From Combination Of Nmr And Aqueous And Contrast-matched Saxs Data Length = 148 Back     alignment and structure
>pdb|1CLM|A Chain A, Structure Of Paramecium Tetraurelia Calmodulin At 1.8 Angstroms Resolution Length = 148 Back     alignment and structure
>pdb|1DMO|A Chain A, Calmodulin, Nmr, 30 Structures Length = 148 Back     alignment and structure
>pdb|1AHR|A Chain A, Calmodulin Mutant With A Two Residue Deletion In The Central Helix Length = 146 Back     alignment and structure
>pdb|2VAY|A Chain A, Calmodulin Complexed With Cav1.1 Iq Peptide Length = 146 Back     alignment and structure
>pdb|4GOW|D Chain D, Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX COMPLEX Length = 144 Back     alignment and structure
>pdb|1CDM|A Chain A, Modulation Of Calmodulin Plasticity In Molecular Recognition On The Basis Of X-Ray Structures Length = 144 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 Back     alignment and structure
>pdb|2IX7|A Chain A, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 145 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|3K21|A Chain A, Crystal Structure Of Carboxy-Terminus Of Pfc0420w Length = 191 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|1Y0V|H Chain H, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate Length = 146 Back     alignment and structure
>pdb|1K93|D Chain D, Crystal Structure Of The Adenylyl Cyclase Domain Of Anthrax Edema Factor (Ef) In Complex With Calmodulin Length = 144 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|1YXS|A Chain A, Crystal Structure Of Kinase Pim1 With P123m Mutation Length = 293 Back     alignment and structure
>pdb|1DEG|A Chain A, The Linker Of Des-Glu84 Calmodulin Is Bent As Seen In The Crystal Structure Length = 142 Back     alignment and structure
>pdb|2XJ0|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-4 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|3UIX|A Chain A, Crystal Structure Of Pim1 Kinase In Complex With Small Molecule Inhibitor Length = 298 Back     alignment and structure
>pdb|1QTX|A Chain A, The 1.65 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|1XQZ|A Chain A, Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolution Length = 300 Back     alignment and structure
>pdb|2XIX|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-1 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|2XIY|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-2 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|2WTK|C Chain C, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 305 Back     alignment and structure
>pdb|3F2A|A Chain A, Crystal Structure Of Human Pim-1 In Complex With Dappa Length = 300 Back     alignment and structure
>pdb|1VRK|A Chain A, The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|3A99|A Chain A, Structure Of Pim-1 Kinase Crystallized In The Presence Of P27kip1 Carboxy-Terminal Peptide Length = 320 Back     alignment and structure
>pdb|3JXW|A Chain A, Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4-Ones As Potent, Highly Selective And Orally Bioavailable Pim Kinases Inhibitors Length = 294 Back     alignment and structure
>pdb|4ALV|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|3R00|A Chain A, The Discovery Of Novel Benzofuran-2-Carboxylic Acids As Potent Pim-1 Inhibitors Length = 299 Back     alignment and structure
>pdb|1XWS|A Chain A, Crystal Structure Of The Human Pim1 Kinase Domain Length = 313 Back     alignment and structure
>pdb|1YWV|A Chain A, Crystal Structures Of Proto-Oncogene Kinase Pim1: A Target Of Aberrant Somatic Hypermutations In Diffuse Large Cell Lymphoma Length = 293 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|2IWI|A Chain A, Crystal Structure Of The Human Pim2 In Complex With A Ruthenium Organometallic Ligand Ru1 Length = 312 Back     alignment and structure
>pdb|2OBJ|A Chain A, Crystal Structure Of Human Pim-1 Kinase In Complex With Inhibitor Length = 333 Back     alignment and structure
>pdb|3DCV|A Chain A, Crystal Structure Of Human Pim1 Kinase Complexed With 4-(4- Hydroxy-3-Methyl-Phenyl)-6-Phenylpyrimidin-2(1h)-One Length = 328 Back     alignment and structure
>pdb|4A7C|A Chain A, Crystal Structure Of Pim1 Kinase With Etp46546 Length = 308 Back     alignment and structure
>pdb|3CXW|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Beta Carboline Ligand I Length = 314 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|3JPV|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Pyrrolo[2,3- A]carbazole Ligand Length = 313 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|4DTK|A Chain A, Novel And Selective Pan-Pim Kinase Inhibitor Length = 276 Back     alignment and structure
>pdb|2J2I|B Chain B, Crystal Structure Of The Humab Pim1 In Complex With Ly333531 Length = 312 Back     alignment and structure
>pdb|2BIL|B Chain B, The Human Protein Kinase Pim1 In Complex With Its Consensus Peptide Pimtide Length = 313 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|3C4E|A Chain A, Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7- Azaindole Length = 273 Back     alignment and structure
>pdb|1Y6W|A Chain A, Trapped Intermediate Of Calmodulin Length = 148 Back     alignment and structure
>pdb|3MA3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Naphtho-Difuran Ligand Length = 313 Back     alignment and structure
>pdb|2BIK|B Chain B, Human Pim1 Phosphorylated On Ser261 Length = 313 Back     alignment and structure
>pdb|3CY3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And The Jnk Inhibitor V Length = 314 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|1YHS|A Chain A, Crystal Structure Of Pim-1 Bound To Staurosporine Length = 273 Back     alignment and structure
>pdb|1QS7|A Chain A, The 1.8 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 145 Back     alignment and structure
>pdb|4AS0|A Chain A, Cyclometalated Phthalimides As Protein Kinase Inhibitors Length = 273 Back     alignment and structure
>pdb|1RFJ|A Chain A, Crystal Structure Of Potato Calmodulin Pcm6 Length = 149 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|2L1W|A Chain A, The Solution Structure Of Soybean Calmodulin Isoform 4 Complexed With The Vacuolar Calcium Atpase Bca1 Peptide Length = 149 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2LHI|A Chain A, Solution Structure Of Ca2+CNA1 PEPTIDE-Bound Ycam Length = 176 Back     alignment and structure
>pdb|1NIW|A Chain A, Crystal Structure Of Endothelial Nitric Oxide Synthase Peptide Bound To Calmodulin Length = 148 Back     alignment and structure
>pdb|1GGZ|A Chain A, Crystal Structure Of The Calmodulin-Like Protein (Hclp) From Human Epithelial Cells Length = 148 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|4AQR|A Chain A, Crystal Structure Of A Calmodulin In Complex With The Regulatory Domain Of A Plasma-Membrane Ca2+-Atpase Length = 149 Back     alignment and structure
>pdb|1XFX|O Chain O, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 10 Millimolar Exogenously Added Calcium Chloride Length = 149 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|3EKJ|A Chain A, Calcium-Free Gcamp2 (Calcium Binding Deficient Mutant) Length = 449 Back     alignment and structure
>pdb|1NA7|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 Length = 329 Back     alignment and structure
>pdb|2ZMC|A Chain A, Crystal Structure Of Human Mitotic Checkpoint Kinase Mps1 Catalytic Domain Apo Form Length = 390 Back     alignment and structure
>pdb|3HMN|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With Atp Length = 342 Back     alignment and structure
>pdb|2ZMD|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain T686a Mutant In Complex With Sp600125 Inhibitor Length = 390 Back     alignment and structure
>pdb|3KHE|A Chain A, Crystal Structure Of The Calcium-Loaded Calmodulin-Like Domain Of The Cdpk, 541.M00134 From Toxoplasma Gondii Length = 191 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3DBQ|A Chain A, Crystal Structure Of Ttk Kinase Domain Length = 343 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 Back     alignment and structure
>pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 Back     alignment and structure
>pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 Back     alignment and structure
>pdb|3CEK|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (ttk) Length = 313 Back     alignment and structure
>pdb|3H9F|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (Ttk) In Complex With A Pyrimido-Diazepin Ligand Length = 313 Back     alignment and structure
>pdb|2X9E|A Chain A, Human Mps1 In Complex With Nms-P715 Length = 317 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|4DS7|A Chain A, Crystal Structure Of Yeast Calmodulin Bound To The C-Terminal Fragment Of Spindle Pole Body Protein Spc110 Length = 147 Back     alignment and structure
>pdb|3O4Y|A Chain A, Crystal Structure Of Cad Domain Of The Plasmodium Vivax Cdpk, Pvx_11610 Length = 196 Back     alignment and structure
>pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 Back     alignment and structure
>pdb|1LKJ|A Chain A, Nmr Structure Of Apo Calmodulin From Yeast Saccharomyces Cerevisiae Length = 146 Back     alignment and structure
>pdb|3VQU|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With 4- [(4-Amino-5-Cyano-6-Ethoxypyridin-2- Yl)amino]benzamide Length = 320 Back     alignment and structure
>pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 Back     alignment and structure
>pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 Back     alignment and structure
>pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2PUU|A Chain A, Crystal Structure Of P38 Complex With 1-(5-Tert-Butyl-2-P- Tolyl-2h-Pyrazol-3-Yl)-3-[4-(6-Morpholin-4-Ylmethyl- Pyridin-3-Yl)naphthalen-1-Yl]urea Length = 348 Back     alignment and structure
>pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 Back     alignment and structure
>pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 Back     alignment and structure
>pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 Back     alignment and structure
>pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 Back     alignment and structure
>pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 Back     alignment and structure
>pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 Back     alignment and structure
>pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 Back     alignment and structure
>pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 Back     alignment and structure
>pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 Back     alignment and structure
>pdb|4ALU|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 Back     alignment and structure
>pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 Back     alignment and structure
>pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 Back     alignment and structure
>pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 Back     alignment and structure
>pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 Back     alignment and structure
>pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 Back     alignment and structure
>pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 Back     alignment and structure
>pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 Back     alignment and structure
>pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 Back     alignment and structure
>pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 Back     alignment and structure
>pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 Back     alignment and structure
>pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 Back     alignment and structure
>pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 Back     alignment and structure
>pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 Back     alignment and structure
>pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 Back     alignment and structure
>pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 Back     alignment and structure
>pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 Back     alignment and structure
>pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 Back     alignment and structure
>pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 Back     alignment and structure
>pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 Back     alignment and structure
>pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 Back     alignment and structure
>pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 Back     alignment and structure
>pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 Back     alignment and structure
>pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 Back     alignment and structure
>pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 Back     alignment and structure
>pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 Back     alignment and structure
>pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 Back     alignment and structure
>pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 Back     alignment and structure
>pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 Back     alignment and structure
>pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 Back     alignment and structure
>pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 Back     alignment and structure
>pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 Back     alignment and structure
>pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 Back     alignment and structure
>pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 Back     alignment and structure
>pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 Back     alignment and structure
>pdb|2F9G|A Chain A, Crystal Structure Of Fus3 Phosphorylated On Tyr182 Length = 353 Back     alignment and structure
>pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 Back     alignment and structure
>pdb|2B9F|A Chain A, Crystal Structure Of Non-Phosphorylated Fus3 Length = 353 Back     alignment and structure
>pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 Back     alignment and structure
>pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 Back     alignment and structure
>pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 Back     alignment and structure
>pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 Back     alignment and structure
>pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 Back     alignment and structure
>pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Staurosporine Length = 424 Back     alignment and structure
>pdb|1I09|A Chain A, Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Length = 420 Back     alignment and structure
>pdb|3SAY|A Chain A, Crystal Structure Of Human Glycogen Synthase Kinase 3 Beta (Gsk3b) In Complex With Inhibitor 142 Length = 430 Back     alignment and structure
>pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pnp Length = 422 Back     alignment and structure
>pdb|1Q5K|A Chain A, Crystal Structure Of Glycogen Synthase Kinase 3 In Complexed With Inhibitor Length = 414 Back     alignment and structure
>pdb|2B9H|A Chain A, Crystal Structure Of Fus3 With A Docking Motif From Ste7 Length = 353 Back     alignment and structure
>pdb|3L19|A Chain A, Crystal Structure Of Calcium Binding Domain Of Cpcdpk3, Cgd5_820 Length = 214 Back     alignment and structure
>pdb|4ACC|A Chain A, Gsk3b In Complex With Inhibitor Length = 465 Back     alignment and structure
>pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 Back     alignment and structure
>pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|1A2X|A Chain A, Complex Of Troponin C With A 47 Residue (1-47) Fragment Of Troponin I Length = 159 Back     alignment and structure
>pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 Back     alignment and structure
>pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 Back     alignment and structure
>pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 Back     alignment and structure
>pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|4DIT|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Imidazopyridine Inhibitor Length = 382 Back     alignment and structure
>pdb|2LMT|A Chain A, Nmr Structure Of Androcam Length = 148 Back     alignment and structure
>pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 Back     alignment and structure
>pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 Back     alignment and structure
>pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 Back     alignment and structure
>pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With Frattide Peptide Length = 378 Back     alignment and structure
>pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 Back     alignment and structure
>pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 Back     alignment and structure
>pdb|4AFJ|A Chain A, 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selective Gsk-3 Inhibitors Length = 367 Back     alignment and structure
>pdb|2I6L|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 6 (Mapk6) Length = 320 Back     alignment and structure
>pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 Back     alignment and structure
>pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|3ZRK|A Chain A, Identification Of 2-(4-Pyridyl)thienopyridinones As Gsk-3beta Inhibitors Length = 371 Back     alignment and structure
>pdb|1TCF|A Chain A, Crystal Structure Of Calcium-Saturated Rabbit Skeletal Troponin C Length = 159 Back     alignment and structure
>pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 Back     alignment and structure
>pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 Back     alignment and structure
>pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 Back     alignment and structure
>pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 Back     alignment and structure
>pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 Back     alignment and structure
>pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 Back     alignment and structure
>pdb|2OW3|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With Bis- (Indole)maleimide Pyridinophane Inhibitor Length = 352 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|3GB2|A Chain A, Gsk3beta Inhibitor Complex Length = 353 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|3ZDI|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide And Inhibitor 7d Length = 350 Back     alignment and structure
>pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 Back     alignment and structure
>pdb|3F7Z|A Chain A, X-ray Co-crystal Structure Of Glycogen Synthase Kinase 3beta In Complex With An Inhibitor Length = 350 Back     alignment and structure
>pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|1DS5|A Chain A, Dimeric Crystal Structure Of The Alpha Subunit In Complex With Two Beta Peptides Mimicking The Architecture Of The Tetrameric Protein Kinase Ck2 Holoenzyme. Length = 332 Back     alignment and structure
>pdb|4ANM|A Chain A, Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 Back     alignment and structure
>pdb|2QC6|A Chain A, Protein Kinase Ck2 In Complex With Dbc Length = 332 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|3EB0|A Chain A, Crystal Structure Of Cgd4_240 From Cryptosporidium Parvum In Complex With Indirubin E804 Length = 383 Back     alignment and structure
>pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|3QRX|A Chain A, Chlamydomonas Reinhardtii Centrin Bound To Melittin Length = 169 Back     alignment and structure
>pdb|3PVG|A Chain A, Crystal Structure Of Z. Mays Ck2 Alpha Subunit In Complex With The Inhibitor 4,5,6,7-Tetrabromo-1-Carboxymethylbenzimidazole (K68) Length = 331 Back     alignment and structure
>pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 Back     alignment and structure
>pdb|3F88|A Chain A, Glycogen Synthase Kinase 3beta Inhibitor Complex Length = 349 Back     alignment and structure
>pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|1DAW|A Chain A, Crystal Structure Of A Binary Complex Of Protein Kinase Ck2 (Alpha-Subunit) And Mg-Amppnp Length = 327 Back     alignment and structure
>pdb|1M2P|A Chain A, Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- AnthraquinoneCK2 KINASE COMPLEX Length = 325 Back     alignment and structure
>pdb|2PVH|A Chain A, Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]triazine Derivatives As Potent Inhibitors Of Protein Kinase Ck2 Length = 352 Back     alignment and structure
>pdb|3KXG|A Chain A, Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subunit In Complex With The Inhibitor 3,4,5,6,7-Pentabromo-1h-Indazole (K64) Length = 327 Back     alignment and structure
>pdb|4DGM|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Apigenin Length = 326 Back     alignment and structure
>pdb|4DGN|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Luteolin Length = 326 Back     alignment and structure
>pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide Length = 350 Back     alignment and structure
>pdb|1TNW|A Chain A, Nmr Solution Structure Of Calcium Saturated Skeletal Muscle Troponin C Length = 162 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|1YTZ|C Chain C, Crystal Structure Of Skeletal Muscle Troponin In The Ca2+- Activated State Length = 162 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|2W49|0 Chain 0, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 159 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|4TNC|A Chain A, Refined Structure Of Chicken Skeletal Muscle Troponin C In The Two-Calcium State At 2-Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|5TNC|A Chain A, Refined Crystal Structure Of Troponin C From Turkey Skeletal Muscle At 2.0 Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|3SLS|A Chain A, Crystal Structure Of Human Mek-1 Kinase In Complex With Ucb1353770 And Amppnp Length = 304 Back     alignment and structure
>pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3U87|A Chain A, Structure Of A Chimeric Construct Of Human Ck2alpha And Human Ck2alpha' In Complex With A Non-hydrolysable Atp-analogue Length = 349 Back     alignment and structure
>pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 Back     alignment and structure
>pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 Back     alignment and structure
>pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 Back     alignment and structure
>pdb|3JUH|A Chain A, Crystal Structure Of A Mutant Of Human Protein Kinase Ck2alpha With Altered Cosubstrate Specificity Length = 335 Back     alignment and structure
>pdb|4EC8|A Chain A, Structure Of Full Length Cdk9 In Complex With Cyclint And Drb Length = 373 Back     alignment and structure
>pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 Back     alignment and structure
>pdb|3OFM|A Chain A, Structure Of A Human Ck2alpha Prime, The Paralog Isoform Of The Catalytic Subunit Of Protein Kinase Ck2 From Homo Sapiens Length = 350 Back     alignment and structure
>pdb|4BCF|A Chain A, Structure Of Cdk9 In Complex With Cyclin T And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 331 Back     alignment and structure
>pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 Back     alignment and structure
>pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|3Q9W|A Chain A, Crystal Structure Of Human Ck2 Alpha In Complex With Emodin At Ph 8.5 Length = 336 Back     alignment and structure
>pdb|2R7I|A Chain A, Crystal Structure Of Catalytic Subunit Of Protein Kinase Ck2 Length = 335 Back     alignment and structure
>pdb|3NGA|A Chain A, Human Ck2 Catalytic Domain In Complex With Cx-4945 Length = 333 Back     alignment and structure
>pdb|4DGL|C Chain C, Crystal Structure Of The Ck2 Tetrameric Holoenzyme Length = 335 Back     alignment and structure
>pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 Back     alignment and structure
>pdb|1JWH|A Chain A, Crystal Structure Of Human Protein Kinase Ck2 Holoenzyme Length = 337 Back     alignment and structure
>pdb|3H30|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 With 5,6-Dichloro-1-Beta-D- Ribofuranosylbenzimidazole Length = 334 Back     alignment and structure
>pdb|3BQC|A Chain A, High Ph-Value Crystal Structure Of Emodin In Complex With The Catalytic Subunit Of Protein Kinase Ck2 Length = 335 Back     alignment and structure
>pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 Back     alignment and structure
>pdb|1PJK|A Chain A, Crystal Structure Of A C-terminal Deletion Mutant Of Human Protein Kinase Ck2 Catalytic Subunit Length = 334 Back     alignment and structure
>pdb|2ZJW|A Chain A, Crystal Structure Of Human Ck2 Alpha Complexed With Ellagic Acid Length = 340 Back     alignment and structure
>pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 Back     alignment and structure
>pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 Back     alignment and structure
>pdb|3MI9|A Chain A, Crystal Structure Of Hiv-1 Tat Complexed With Human P-Tefb Length = 351 Back     alignment and structure
>pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 Back     alignment and structure
>pdb|3BLH|A Chain A, Crystal Structure Of Human Cdk9CYCLINT1 Length = 331 Back     alignment and structure
>pdb|3MB6|A Chain A, Human Ck2 Catalytic Domain In Complex With A Difurane Derivative Inhibitor (Cpa) Length = 331 Back     alignment and structure
>pdb|3NSZ|A Chain A, Human Ck2 Catalytic Domain In Complex With Amppn Length = 330 Back     alignment and structure
>pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 Back     alignment and structure
>pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 Back     alignment and structure
>pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 Back     alignment and structure
>pdb|3Q04|A Chain A, Crystal Structure Of The Apo-Form Of Human Ck2 Alpha At Ph 8.5 Length = 328 Back     alignment and structure
>pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 Back     alignment and structure
>pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 Back     alignment and structure
>pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 Back     alignment and structure
>pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 Back     alignment and structure
>pdb|4AN2|A Chain A, Crystal Structures Of Human Mek1 With Carboxamide-Based Allosteric Inhibitor Xl518 (Gdc-0973), Or Related Analogs. Length = 301 Back     alignment and structure
>pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 Back     alignment and structure
>pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 Back     alignment and structure
>pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 Back     alignment and structure
>pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 Back     alignment and structure
>pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|3E3B|X Chain X, Crystal Structure Of Catalytic Subunit Of Human Protein Kinase Ck2alpha Prime With A Potent Indazole-Derivative Inhibitor Length = 339 Back     alignment and structure
>pdb|2LHH|A Chain A, Solution Structure Of Ca2+-Bound Ycam Length = 128 Back     alignment and structure
>pdb|2LHH|A Chain A, Solution Structure Of Ca2+-Bound Ycam Length = 128 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|3KF9|A Chain A, Crystal Structure Of The SdcenSKMLCK COMPLEX Length = 149 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 Back     alignment and structure
>pdb|2LAN|A Chain A, Nmr Structure Of Ca2+-Bound Cabp1 N-Domain With Rdc Length = 167 Back     alignment and structure
>pdb|3ORN|A Chain A, Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In Complex With Ch4987655 And Mgamp-Pnp Length = 307 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|3OX5|A Chain A, Crystal Structure Of The Calcium Sensor Calcium-Binding Protein 1 (Cabp1) Length = 153 Back     alignment and structure
>pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 Back     alignment and structure
>pdb|3OX6|A Chain A, Crystal Structure Of The Calcium Sensor Calcium-Binding Protein 1 (Cabp1) Length = 153 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|1Z57|A Chain A, Crystal Structure Of Human Clk1 In Complex With 10z-Hymenialdisine Length = 339 Back     alignment and structure
>pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 Back     alignment and structure
>pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 Back     alignment and structure
>pdb|3KVW|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) In Complex With An Indirubin Ligand Length = 429 Back     alignment and structure
>pdb|4AZF|A Chain A, Human Dyrk2 In Complex With Leucettine L41 Length = 417 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|2OBH|A Chain A, Centrin-Xpc Peptide Length = 143 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|2VAG|A Chain A, Crystal Structure Of Di-Phosphorylated Human Clk1 In Complex With A Novel Substituted Indole Inhibitor Length = 339 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|3P23|A Chain A, Crystal Structure Of The Human Kinase And Rnase Domains In Complex With Adp Length = 432 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|2Y4I|C Chain C, Ksr2-Mek1 Heterodimer Length = 395 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|4EUU|A Chain A, Structure Of Bx-795 Complexed With Human Tbk1 Kinase Domain Phosphorylated On Ser172 Length = 319 Back     alignment and structure
>pdb|3K2L|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) Length = 429 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|4EUT|A Chain A, Structure Of Bx-795 Complexed With Unphosphorylated Human Tbk1 Kinase- Uld Domain Length = 396 Back     alignment and structure
>pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|3FWB|A Chain A, Sac3:sus1:cdc31 Complex Length = 161 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3EQC|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Ternary Complex With Compound 1, Atp-Gs And Mg2p Length = 360 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|2WU6|A Chain A, Crystal Structure Of The Human Clk3 In Complex With Dki Length = 381 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|2EXE|A Chain A, Crystal Structure Of The Phosphorylated Clk3 Length = 357 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|1LA0|A Chain A, Solution Structure Of Calcium Saturated Cardiac Troponin C In The Troponin C-Troponin I Complex Length = 161 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|2EU9|A Chain A, Crystal Structure Of Clk3 Length = 355 Back     alignment and structure
>pdb|1S9J|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 341 Back     alignment and structure
>pdb|2P55|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 333 Back     alignment and structure
>pdb|3MBL|A Chain A, Crystal Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek 1) In Complex With Ligand And Mgadp Length = 328 Back     alignment and structure
>pdb|3DV3|A Chain A, Mek1 With Pf-04622664 Bound Length = 322 Back     alignment and structure
>pdb|1HOW|A Chain A, The X-Ray Crystal Structure Of Sky1p, An Sr Protein Kinase In Yeast Length = 373 Back     alignment and structure
>pdb|1Q8Y|A Chain A, The Structure Of The Yeast Sr Protein Kinase, Sky1p, With Bound Adp Length = 373 Back     alignment and structure
>pdb|1AJ4|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 1 Structure Length = 161 Back     alignment and structure
>pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 Back     alignment and structure
>pdb|2JT0|A Chain A, Solution Structure Of F104w Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2JT3|A Chain A, Solution Structure Of F153w Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|3NR9|A Chain A, Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length = 368 Back     alignment and structure
>pdb|1DTL|A Chain A, Crystal Structure Of Calcium-Saturated (3ca2+) Cardiac Troponin C Complexed With The Calcium Sensitizer Bepridil At 2.15 A Resolution Length = 161 Back     alignment and structure
>pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 Back     alignment and structure
>pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 Back     alignment and structure
>pdb|3FME|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 6 (Mek6) Activated Mutant (S207d, T211d) Length = 290 Back     alignment and structure
>pdb|2BL0|C Chain C, Physarum Polycephalum Myosin Ii Regulatory Domain Length = 142 Back     alignment and structure
>pdb|2A19|B Chain B, Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Length = 284 Back     alignment and structure
>pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Kinase Domain Length = 306 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|2GV5|A Chain A, Crystal Structure Of Sfi1pCDC31P COMPLEX Length = 161 Back     alignment and structure
>pdb|2IN6|A Chain A, Wee1 Kinase Complex With Inhibitor Pd311839 Length = 287 Back     alignment and structure
>pdb|2PML|X Chain X, Crystal Structure Of Pfpk7 In Complex With An Atp Analogue Length = 348 Back     alignment and structure
>pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092, Delete A660- T867) At 2.28 A Resolution Length = 299 Back     alignment and structure
>pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 Back     alignment and structure
>pdb|2JTZ|A Chain A, Solution Structure And Chemical Shift Assignments Of The F104-To-5-Flurotryptophan Mutant Of Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2JT8|A Chain A, Solution Structure Of The F153-To-5-Flurotryptophan Mutant Of Human Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|2Z2W|A Chain A, Humand Wee1 Kinase Complexed With Inhibitor Pf0335770 Length = 285 Back     alignment and structure
>pdb|3BI6|A Chain A, Wee1 Kinase Complex With Inhibitor Pd352396 Length = 287 Back     alignment and structure
>pdb|1X8B|A Chain A, Structure Of Human Wee1a Kinase: Kinase Domain Complexed With Inhibitor Pd0407824 Length = 289 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|1ZXE|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n Inactivating Mutant In Apo Form Length = 303 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|3N9X|A Chain A, Crystal Structure Of Map Kinase From Plasmodium Berghei, Pb000659.00.0 Length = 432 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|3ANQ|A Chain A, Human Dyrk1aINHIBITOR COMPLEX Length = 368 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|2VX3|A Chain A, Crystal Structure Of The Human Dual Specificity Tyrosine- Phosphorylation-Regulated Kinase 1a Length = 382 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|3ENM|A Chain A, The Structure Of The Map2k Mek6 Reveals An Autoinhibitory Dimer Length = 316 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|2GGM|A Chain A, Human Centrin 2 Xeroderma Pigmentosum Group C Protein Complex Length = 172 Back     alignment and structure
>pdb|4AZE|A Chain A, Human Dyrk1a In Complex With Leucettine L41 Length = 382 Back     alignment and structure
>pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|4DN5|A Chain A, Crystal Structure Of Nf-kb-inducing Kinase (nik) Length = 356 Back     alignment and structure
>pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|2JNF|A Chain A, Solution Structure Of Fly Troponin C, Isoform F1 Length = 158 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|3SDJ|A Chain A, Structure Of Rnase-Inactive Point Mutant Of Oligomeric KinaseRNASE Ire1 Length = 448 Back     alignment and structure
>pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 Back     alignment and structure
>pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 Back     alignment and structure
>pdb|3FBV|A Chain A, Crystal Structure Of The Oligomer Formed By The Kinase-Ribonuclease Domain Of Ire1 Length = 448 Back     alignment and structure
>pdb|3E3R|A Chain A, Crystal Structure And Biochemical Characterization Of Recombinant Human Calcyphosine Delineates A Novel Ef-hand-containing Protein Family Length = 204 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 Back     alignment and structure
>pdb|3RP9|A Chain A, Crystal Structure Of The Apo Mapk From Toxoplasma Gondii, 25.M01780 Or Tgme49_007820 Length = 458 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|1U59|A Chain A, Crystal Structure Of The Zap-70 Kinase Domain In Complex With Staurosporine Length = 287 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|3LL6|A Chain A, Crystal Structure Of The Human Cyclin G Associated Kinase (gak) Length = 337 Back     alignment and structure
>pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|1MF8|B Chain B, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 170 Back     alignment and structure
>pdb|1TCO|B Chain B, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 169 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|2P6B|B Chain B, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 156 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|3LL8|B Chain B, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 155 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|3P1A|A Chain A, Structure Of Human Membrane-Associated Tyrosine- And Threonine- Specific Cdc2-Inhibitory Kinase Myt1 (Pkmyt1) Length = 311 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|2DYL|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 7 Activated Mutant (S287d, T291d) Length = 318 Back     alignment and structure
>pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|4G3D|A Chain A, Crystal Structure Of Human Nf-kappab Inducing Kinase (nik) Length = 371 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|4F99|A Chain A, Human Cdc7 Kinase In Complex With Dbf4 And Nucleotide Length = 361 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|1S9I|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 2 (Mek2)in A Complex With Ligand And Mgatp Length = 354 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|2OZO|A Chain A, Autoinhibited Intact Human Zap-70 Length = 613 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|3LJ0|A Chain A, Ire1 Complexed With Adp And Quercetin Length = 434 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|2RIO|A Chain A, Structure Of The Dual Enzyme Ire1 Reveals The Basis For Catalysis And Regulation Of Non-conventional Splicing Length = 434 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|3RGF|A Chain A, Crystal Structure Of Human Cdk8CYCC Length = 405 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|1ZOT|B Chain B, Crystal Structure Analysis Of The CyaaC-Cam With Pmeapp Length = 69 Back     alignment and structure
>pdb|1RJB|A Chain A, Crystal Structure Of Flt3 Length = 344 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|1F71|A Chain A, Refined Solution Structure Of Calmodulin C-Terminal Domain Length = 67 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|1YRU|B Chain B, Crystal Structure Analysis Of The Adenylyl Cyclaes Catalytic Domain Of Adenylyl Cyclase Toxin Of Bordetella Pertussis In Presence Of C-Terminal Calmodulin And 1mm Calcium Chloride Length = 74 Back     alignment and structure
>pdb|4G3G|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) V408l Bound To A 2-(aminothiazolyl)phenol (cmp3) Length = 350 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|1CMF|A Chain A, Nmr Solution Structure Of Apo Calmodulin Carboxy-Terminal Domain Length = 73 Back     alignment and structure
>pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|2OH4|A Chain A, Crystal Structure Of Vegfr2 With A Benzimidazole-Urea Inhibitor Length = 316 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|3QUP|A Chain A, Inhibitor Bound Structure Of The Kinase Domain Of The Murine Receptor Tyrosine Kinase Tyro3 (Sky) Length = 323 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|1FW4|A Chain A, Crystal Structure Of E. Coli Fragment Tr2c From Calmodulin To 1.7 A Resolution Length = 71 Back     alignment and structure
>pdb|1F70|A Chain A, Refined Solution Structure Of Calmodulin N-Terminal Domain Length = 76 Back     alignment and structure
>pdb|1F70|A Chain A, Refined Solution Structure Of Calmodulin N-Terminal Domain Length = 76 Back     alignment and structure
>pdb|3B32|A Chain A, Crystal Structure Of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-75 Length = 75 Back     alignment and structure
>pdb|3B32|A Chain A, Crystal Structure Of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-75 Length = 75 Back     alignment and structure
>pdb|1AK8|A Chain A, Nmr Solution Structure Of Cerium-Loaded Calmodulin Amino- Terminal Domain (Ce2-Tr1c), 23 Structures Length = 76 Back     alignment and structure
>pdb|1AK8|A Chain A, Nmr Solution Structure Of Cerium-Loaded Calmodulin Amino- Terminal Domain (Ce2-Tr1c), 23 Structures Length = 76 Back     alignment and structure
>pdb|2COL|B Chain B, Crystal Structure Analysis Of CyaaC-Cam With Pyrophosphate Length = 67 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3UCT|A Chain A, Structure Of Mn2+-Bound N-Terminal Domain Of Calmodulin In The Presence Of Zn2+ Length = 79 Back     alignment and structure
>pdb|3UCT|A Chain A, Structure Of Mn2+-Bound N-Terminal Domain Of Calmodulin In The Presence Of Zn2+ Length = 79 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|4G3F|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) Bound To A 2-(aminothiazoly)phenol (cmp2) Length = 336 Back     alignment and structure
>pdb|1VR2|A Chain A, Human Vascular Endothelial Growth Factor Receptor 2 (Kdr) Kinase Domain Length = 316 Back     alignment and structure
>pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|3NIE|A Chain A, Crystal Structure Of Pf11_0147 Length = 429 Back     alignment and structure
>pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 Back     alignment and structure
>pdb|4G3C|A Chain A, Crystal Structure Of Apo Murine Nf-kappab Inducing Kinase (nik) Length = 352 Back     alignment and structure
>pdb|4HZS|A Chain A, Crystal Structure Of Ack1 Kinase Domain With C-terminal Sh3 Domain Length = 341 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|1U54|A Chain A, Crystal Structures Of The Phosphorylated And Unphosphorylated Kinase Domains Of The Cdc42-Associated Tyrosine Kinase Ack1 Bound To Amp-Pcp Length = 291 Back     alignment and structure
>pdb|1F54|A Chain A, Solution Structure Of The Apo N-Terminal Domain Of Yeast Calmodulin Length = 77 Back     alignment and structure
>pdb|1F54|A Chain A, Solution Structure Of The Apo N-Terminal Domain Of Yeast Calmodulin Length = 77 Back     alignment and structure
>pdb|3VNT|A Chain A, Crystal Structure Of The Kinase Domain Of Human Vegfr2 With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 318 Back     alignment and structure
>pdb|2BL0|B Chain B, Physarum Polycephalum Myosin Ii Regulatory Domain Length = 145 Back     alignment and structure
>pdb|4EWH|B Chain B, Co-Crystal Structure Of Ack1 With Inhibitor Length = 275 Back     alignment and structure
>pdb|2LQC|A Chain A, Nmr Solution Structure Of A Ca2+-Calmodulin With A Binding Motif (Nscate) Peptide From The N-Terminal Cytoplasmic Domain Of The L-Type Voltage-Cated Calcium Channel Alpha1c Subunit Length = 77 Back     alignment and structure
>pdb|2LQC|A Chain A, Nmr Solution Structure Of A Ca2+-Calmodulin With A Binding Motif (Nscate) Peptide From The N-Terminal Cytoplasmic Domain Of The L-Type Voltage-Cated Calcium Channel Alpha1c Subunit Length = 77 Back     alignment and structure
>pdb|2I08|A Chain A, Solvation Effect In Conformational Changes Of Ef-Hand Proteins: X-Ray Structure Of Ca2+-Saturated Double Mutant Q41l-K75i Of N-Domain Of Calmodulin Length = 78 Back     alignment and structure
>pdb|2I08|A Chain A, Solvation Effect In Conformational Changes Of Ef-Hand Proteins: X-Ray Structure Of Ca2+-Saturated Double Mutant Q41l-K75i Of N-Domain Of Calmodulin Length = 78 Back     alignment and structure
>pdb|1U46|A Chain A, Crystal Structure Of The Unphosphorylated Kinase Domain Of The Tyrosine Kinase Ack1 Length = 291 Back     alignment and structure
>pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 Back     alignment and structure
>pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 Back     alignment and structure
>pdb|2LLO|A Chain A, Solution Nmr-Derived Structure Of Calmodulin N-Lobe Bound With Er Alpha Peptide Length = 80 Back     alignment and structure
>pdb|2LLO|A Chain A, Solution Nmr-Derived Structure Of Calmodulin N-Lobe Bound With Er Alpha Peptide Length = 80 Back     alignment and structure
>pdb|3EQP|B Chain B, Crystal Structure Of Ack1 With Compound T95 Length = 276 Back     alignment and structure
>pdb|4HZR|A Chain A, Crystal Structure Of Ack1 Kinase Domain Length = 277 Back     alignment and structure
>pdb|2RRT|A Chain A, Solution Structure Of Magnesium-Bound Form Of Calmodulin C-Domain E104dE140D MUTANT Length = 72 Back     alignment and structure
>pdb|1J7O|A Chain A, Solution Structure Of Calcium-calmodulin N-terminal Domain Length = 76 Back     alignment and structure
>pdb|1J7O|A Chain A, Solution Structure Of Calcium-calmodulin N-terminal Domain Length = 76 Back     alignment and structure
>pdb|4ID7|A Chain A, Ack1 Kinase In Complex With The Inhibitor Cis-3-[8-amino-1-(4- Phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol Length = 273 Back     alignment and structure
>pdb|2KN2|A Chain A, Solution Structure Of The C-Terminal Domain Of Soybean Calmodulin Isoform 4 Fused With The Calmodulin-Binding Domain Of Ntmkp1 Length = 92 Back     alignment and structure
>pdb|3IFK|A Chain A, Crystal Structure Of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-90 Length = 90 Back     alignment and structure
>pdb|3IFK|A Chain A, Crystal Structure Of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-90 Length = 90 Back     alignment and structure
>pdb|2KXW|A Chain A, Structure Of The C-Domain Fragment Of Apo Calmodulin Bound To The Iq Motif Of Nav1.2 Length = 73 Back     alignment and structure
>pdb|1SW8|A Chain A, Solution Structure Of The N-Terminal Domain Of Human N60d Calmodulin Refined With Paramagnetism Based Strategy Length = 79 Back     alignment and structure
>pdb|1SW8|A Chain A, Solution Structure Of The N-Terminal Domain Of Human N60d Calmodulin Refined With Paramagnetism Based Strategy Length = 79 Back     alignment and structure
>pdb|1YWN|A Chain A, Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]pyrimidine Length = 316 Back     alignment and structure
>pdb|2ROB|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 4 C-Terminal Domain Length = 70 Back     alignment and structure
>pdb|1BJF|A Chain A, Crystal Structure Of Recombinant Bovine Neurocalcin Delta At 2.4 Angstroms Length = 193 Back     alignment and structure
>pdb|2P0C|A Chain A, Catalytic Domain Of The Proto-Oncogene Tyrosine-Protein Kina Length = 313 Back     alignment and structure
>pdb|3CJF|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure
>pdb|2RO8|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 1 N-Terminal Domain Length = 79 Back     alignment and structure
>pdb|2RO8|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 1 N-Terminal Domain Length = 79 Back     alignment and structure
>pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|2P2I|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Nicotinamide Inhibitor Length = 314 Back     alignment and structure
>pdb|3CJG|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|3LLT|A Chain A, Crystal Structure Of Pf14_0431, Kinase Domain Length = 360 Back     alignment and structure
>pdb|3QD2|B Chain B, Crsytal Structure Of Mouse Perk Kinase Domain Length = 332 Back     alignment and structure
>pdb|2P2H|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridinyl-Triazine Inhibitor Length = 314 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3UYS|A Chain A, Crystal Structure Of Apo Human Ck1d Length = 296 Back     alignment and structure
>pdb|1YVJ|A Chain A, Crystal Structure Of The Jak3 Kinase Domain In Complex With A Staurosporine Analogue Length = 290 Back     alignment and structure
>pdb|1CKJ|A Chain A, Casein Kinase I Delta Truncation Mutant Containing Residues 1-317 Complex With Bound Tungstate Length = 317 Back     alignment and structure
>pdb|2B1U|A Chain A, Solution Structure Of Calmodulin-Like Skin Protein C Terminal Domain Length = 71 Back     alignment and structure
>pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|3AAJ|A Chain A, Crystal Structure Of Ca2+-Bound Form Of Des3-23alg-2deltagf122 Length = 167 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query653
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 0.0
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 0.0
3lij_A494 Calcium/calmodulin dependent protein kinase with A 0.0
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 0.0
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 0.0
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 0.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 0.0
2y0a_A326 Death-associated protein kinase 1; transferase, ca 1e-180
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 1e-177
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 1e-175
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 1e-174
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 1e-169
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 1e-169
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 1e-168
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 1e-168
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 1e-167
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 1e-166
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 1e-166
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 1e-164
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 1e-163
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 1e-162
3bhy_A283 Death-associated protein kinase 3; death associate 1e-162
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 1e-162
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-159
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 1e-159
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 1e-158
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 1e-158
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 1e-158
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 1e-157
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 1e-152
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 1e-148
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 1e-141
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 1e-140
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 1e-100
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 1e-99
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 4e-95
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 5e-95
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 4e-88
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 2e-86
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 2e-84
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 2e-83
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 2e-82
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 7e-81
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 3e-80
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 4e-80
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 5e-80
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 3e-79
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 1e-78
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 1e-78
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 1e-78
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 3e-78
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 2e-77
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 3e-77
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 2e-76
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 5e-76
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 1e-75
3dls_A335 PAS domain-containing serine/threonine-protein KI; 4e-75
2eue_A275 Carbon catabolite derepressing protein kinase; kin 3e-74
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 4e-74
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 4e-74
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 1e-73
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 4e-22
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 1e-73
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 2e-73
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 5e-73
1ij5_A 323 Plasmodial specific LAV1-2 protein; fourty kDa cal 1e-23
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 4e-13
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 9e-73
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 2e-72
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 2e-72
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 3e-72
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 4e-71
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 4e-71
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 5e-71
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 8e-67
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 5e-66
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 8e-65
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 5e-64
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 6e-64
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 6e-62
3fwb_A161 Cell division control protein 31; gene gating, com 6e-62
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 1e-61
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 6e-16
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 9e-61
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 4e-60
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 6e-60
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 6e-26
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 9e-60
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 1e-16
2jnf_A158 Troponin C; stretch activated muscle contraction, 4e-59
2jnf_A158 Troponin C; stretch activated muscle contraction, 5e-16
2a19_B284 Interferon-induced, double-stranded RNA-activated 4e-59
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 5e-59
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 6e-16
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 6e-59
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 8e-17
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 6e-12
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 1e-58
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 6e-16
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 2e-58
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 3e-16
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 5e-14
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 4e-58
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 6e-58
1exr_A148 Calmodulin; high resolution, disorder, metal trans 2e-56
1exr_A148 Calmodulin; high resolution, disorder, metal trans 7e-16
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 5e-56
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 2e-55
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 1e-15
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 2e-54
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 3e-54
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 5e-54
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 2e-53
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 2e-53
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 5e-53
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 2e-52
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 3e-15
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 8e-14
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 2e-10
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 4e-52
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 1e-51
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 2e-51
3pvu_A695 Beta-adrenergic receptor kinase 1; transferase, se 4e-51
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 4e-51
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 1e-50
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 4e-50
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 6e-50
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 6e-50
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 5e-15
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 3e-13
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 4e-10
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 2e-49
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 3e-49
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 4e-49
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 4e-49
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 5e-49
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 5e-49
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 8e-49
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 9e-49
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 4e-48
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 6e-48
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 2e-47
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 2e-47
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 4e-11
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 9e-47
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 2e-19
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 1e-11
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 9e-47
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 3e-24
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 1e-46
1y1x_A191 Leishmania major homolog of programmed cell death 1e-46
1y1x_A191 Leishmania major homolog of programmed cell death 1e-22
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 2e-46
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 3e-46
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 3e-14
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 3e-13
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 1e-05
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 6e-46
3akb_A166 Putative calcium binding protein; EF-hand, metal b 1e-45
3akb_A166 Putative calcium binding protein; EF-hand, metal b 2e-15
3akb_A166 Putative calcium binding protein; EF-hand, metal b 3e-14
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 1e-45
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 4e-45
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 7e-45
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 3e-44
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 6e-44
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 7e-44
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 2e-43
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 5e-15
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 4e-12
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-43
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 4e-43
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 2e-35
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 1e-42
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 1e-17
2hps_A186 Coelenterazine-binding protein with bound coelent; 1e-42
2hps_A186 Coelenterazine-binding protein with bound coelent; 2e-15
2hps_A186 Coelenterazine-binding protein with bound coelent; 4e-12
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 3e-41
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 8e-41
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 4e-14
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 7e-11
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 8e-41
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 8e-41
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 1e-40
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 4e-16
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 1e-40
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 3e-13
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 4e-13
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 5e-04
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 2e-40
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 5e-40
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 6e-40
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 3e-31
2dyl_A318 Dual specificity mitogen-activated protein kinase 3e-39
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 3e-39
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 4e-39
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 5e-39
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 8e-06
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 6e-39
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 7e-39
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 2e-38
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 2e-38
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 2e-17
3aln_A327 Dual specificity mitogen-activated protein kinase; 3e-38
3an0_A340 Dual specificity mitogen-activated protein kinase; 5e-38
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 1e-37
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 2e-37
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 1e-20
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 4e-37
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 1e-19
3sg6_A 450 Gcamp2, myosin light chain kinase, green fluoresce 3e-05
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 5e-37
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 9e-37
3fme_A290 Dual specificity mitogen-activated protein kinase; 9e-37
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 1e-36
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 4e-18
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 2e-36
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 5e-10
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 2e-36
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 2e-36
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 3e-36
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 3e-36
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 3e-36
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 3e-24
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 4e-36
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 5e-36
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 1e-35
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 2e-35
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 9e-15
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 2e-35
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 2e-35
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 4e-35
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 8e-35
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 1e-34
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 1e-34
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 2e-34
3o0g_A292 Cell division protein kinase 5; kinase activator c 2e-34
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 2e-34
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 2e-14
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 1e-12
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 3e-34
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 6e-12
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 3e-34
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 3e-34
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 3e-34
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 6e-13
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 3e-34
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 3e-34
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 3e-12
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 6e-34
3niz_A311 Rhodanese family protein; structural genomics, str 8e-34
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 9e-34
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 4e-12
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 7e-11
3eqc_A360 Dual specificity mitogen-activated protein kinase; 2e-33
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 3e-33
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 4e-23
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 2e-09
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 3e-33
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 1e-25
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 5e-33
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 6e-12
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 7e-10
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 6e-33
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 8e-33
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 1e-32
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 1e-32
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 2e-32
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 6e-12
2fst_X367 Mitogen-activated protein kinase 14; active mutant 2e-32
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 2e-32
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 8e-18
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 6e-10
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 2e-32
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 5e-32
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 7e-32
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 7e-32
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 1e-31
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 3e-29
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 1e-31
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 1e-31
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 9e-13
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 2e-31
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 2e-31
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 3e-31
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 1e-30
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 2e-30
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 2e-30
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 2e-30
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 7e-30
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 7e-30
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 8e-30
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 2e-12
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 9e-12
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 1e-29
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 2e-27
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 2e-29
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 3e-29
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 3e-28
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 1e-17
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 3e-11
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 3e-28
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 3e-28
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 1e-17
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 5e-28
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 1e-27
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 1e-27
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 2e-27
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 1e-18
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 2e-27
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 4e-27
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 4e-27
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 5e-16
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 1e-11
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 7e-27
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 9e-27
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 2e-19
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 1e-26
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 1e-26
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 1e-26
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 2e-26
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 1e-25
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 8e-19
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 1e-25
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 2e-24
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 2e-25
3ork_A311 Serine/threonine protein kinase; structural genomi 2e-25
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 5e-25
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 4e-17
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 1e-24
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 3e-17
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 1e-24
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 4e-21
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 8e-24
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 1e-23
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 5e-20
3rp9_A458 Mitogen-activated protein kinase; structural genom 2e-23
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 2e-23
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 6e-20
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 2e-23
3uqc_A286 Probable conserved transmembrane protein; structur 4e-23
3li6_A66 Calcium-binding protein; calcium signaling protein 8e-23
3li6_A66 Calcium-binding protein; calcium signaling protein 9e-16
3li6_A66 Calcium-binding protein; calcium signaling protein 8e-14
3li6_A66 Calcium-binding protein; calcium signaling protein 2e-05
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 4e-22
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 5e-22
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 7e-22
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 1e-21
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 2e-15
3q4u_A301 Activin receptor type-1; structural genomics conso 2e-21
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 6e-21
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 2e-20
1avs_A90 Troponin C; muscle contraction, calcium-activated, 9e-21
1avs_A90 Troponin C; muscle contraction, calcium-activated, 6e-19
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 3e-20
3soc_A322 Activin receptor type-2A; structural genomics cons 6e-20
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 8e-20
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 3e-19
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 1e-19
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 1e-19
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 4e-19
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 9e-19
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 5e-19
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 8e-19
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 2e-18
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 3e-18
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 1e-16
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 8e-18
3a4u_B143 Multiple coagulation factor deficiency protein 2; 1e-17
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 8e-17
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 9e-17
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 8e-12
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 2e-16
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 2e-16
3lzb_A327 Epidermal growth factor receptor; epidermal growth 2e-15
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 5e-15
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 5e-15
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 6e-15
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 7e-15
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 8e-15
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 1e-14
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 1e-14
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 2e-14
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 2e-14
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 2e-14
1c07_A95 Protein (epidermal growth factor receptor pathway 2e-14
1c07_A95 Protein (epidermal growth factor receptor pathway 2e-10
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 3e-14
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 3e-14
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 3e-14
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 7e-12
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 4e-14
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 4e-14
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 5e-14
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 5e-14
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 1e-10
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 6e-14
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 6e-14
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 7e-14
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 5e-10
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 9e-14
3poz_A327 Epidermal growth factor receptor; kinase domain, a 1e-13
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 2e-13
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 3e-13
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 3e-13
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 3e-13
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 4e-13
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 4e-13
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 4e-13
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 4e-13
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 5e-13
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 7e-13
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 8e-13
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 8e-13
2xir_A316 Vascular endothelial growth factor receptor 2; ang 8e-13
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 9e-13
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 9e-13
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 1e-12
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 1e-12
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 1e-12
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 2e-12
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 2e-12
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 2e-12
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 2e-12
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 4e-11
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 2e-12
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 3e-12
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 3e-12
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 3e-12
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 4e-12
4aoj_A329 High affinity nerve growth factor receptor; transf 4e-12
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 5e-12
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 9e-12
3pls_A298 Macrophage-stimulating protein receptor; protein k 1e-11
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 1e-11
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 1e-11
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 3e-11
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 4e-11
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 1e-07
1qjt_A99 EH1, epidermal growth factor receptor substrate su 8e-11
1qjt_A99 EH1, epidermal growth factor receptor substrate su 8e-10
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 6e-10
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 8e-10
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 1e-09
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 9e-09
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 2e-06
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 6e-05
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 2e-09
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 2e-09
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 1e-06
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 3e-04
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 1e-08
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 3e-07
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 2e-08
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 3e-07
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 2e-06
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 7e-05
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 3e-06
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 8e-06
2jq6_A139 EH domain-containing protein 1; metal binding prot 2e-05
2jq6_A139 EH domain-containing protein 1; metal binding prot 2e-05
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 3e-05
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 1e-04
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 4e-05
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 4e-05
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 1e-04
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 2e-04
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 5e-04
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 6e-04
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 7e-04
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 7e-04
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 9e-04
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 7e-04
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 8e-04
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
 Score =  721 bits (1862), Expect = 0.0
 Identities = 167/470 (35%), Positives = 250/470 (53%), Gaps = 16/470 (3%)

Query: 176 SVLQTKTGHLKEYYNLGRKLGNGQFGTTFLCMEKGTGKEYACKSIAKRKLIQKEDVEDVR 235
             +Q  T    + Y   R LG G FG   LC +K TG+E A K I+KR++ QK D E + 
Sbjct: 15  MFVQHSTAIFSDRYKGQRVLGKGSFGEVILCKDKITGQECAVKVISKRQVKQKTDKESLL 74

Query: 236 REIQIMHHLAGHANAVLIKGAYEDSVAVHVVMELCAGGELFDRIIKKGHYTERKAAQLAR 295
           RE+Q++  L  H N + +   +ED    ++V E+  GGELFD II +  ++E  AA++ R
Sbjct: 75  REVQLLKQL-DHPNIMKLYEFFEDKGYFYLVGEVYTGGELFDEIISRKRFSEVDAARIIR 133

Query: 296 TIVGFVETSHSLGVMHRDLKPENFLFVNEHEDSPLKAIDFGLSTFFKPGDIFTDVVGSPY 355
            ++  +   H   ++HRDLKPEN L  ++ +D+ ++ IDFGLST F+      D +G+ Y
Sbjct: 134 QVLSGITYMHKNKIVHRDLKPENLLLESKSKDANIRIIDFGLSTHFEASKKMKDKIGTAY 193

Query: 356 YVSPEVLLKHYGPEADVWSAGVIIYILLSGVPPFWGETEHDIFEEVLHGDLDLSSDPWPK 415
           Y++PEVL   Y  + DVWS GVI+YILLSG PPF G  E+DI ++V  G        W K
Sbjct: 194 YIAPEVLHGTYDEKCDVWSTGVILYILLSGCPPFNGANEYDILKKVEKGKYTFELPQWKK 253

Query: 416 ISENAKDLVRKMLVRDPRKRLTAHEVLCHPWFQI---DGGAPDKPLDSAVLSRLKQFSAM 472
           +SE+AKDL+RKML   P  R++A + L H W Q    +  + D P     +  ++QF   
Sbjct: 254 VSESAKDLIRKMLTYVPSMRISARDALDHEWIQTYTKEQISVDVPSLDNAILNIRQFQGT 313

Query: 473 NKLKKMALRVIAESL-SEEEIAGLKEMFKALDADNSGFITFEELKVGLKRF--------- 522
            KL + AL  +   L S++E   L  +F  +D +  G +   EL  G K           
Sbjct: 314 QKLAQAALLYMGSKLTSQDETKELTAIFHKMDKNGDGQLDRAELIEGYKELMRMKGQDAS 373

Query: 523 --GASLDESEIYDLMQAADVDNSGTIDYGEFIAATLHLNKAQREDHLFAAFSYFDKDGSG 580
              AS  E E+  ++ A D D +G I+Y EF+   +        + L  AF  FD D SG
Sbjct: 374 MLDASAVEHEVDQVLDAVDFDKNGYIEYSEFVTVAMDRKTLLSRERLERAFRMFDSDNSG 433

Query: 581 YITADELQQACDEFGIEDMRLEDLIREVDQDNDGRIDYNEFVAMMHNGNN 630
            I++ EL        ++    + ++ EVD++NDG +D++EF  M+     
Sbjct: 434 KISSTELATIFGVSDVDSETWKSVLSEVDKNNDGEVDFDEFQQMLLKLCG 483


>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Length = 143 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Length = 364 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Length = 174 Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Length = 174 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Length = 106 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Length = 106 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Length = 78 Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Length = 78 Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Length = 179 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Length = 139 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Length = 139 Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Length = 93 Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Length = 93 Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Length = 100 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Length = 103 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Length = 96 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Length = 550 Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Length = 113 Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Length = 93 Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Length = 93 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Length = 90 Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Length = 106 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query653
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 100.0
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 100.0
3lij_A494 Calcium/calmodulin dependent protein kinase with A 100.0
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 100.0
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 100.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
2y0a_A326 Death-associated protein kinase 1; transferase, ca 100.0
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 100.0
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 100.0
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 100.0
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 100.0
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 100.0
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 100.0
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 100.0
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 100.0
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 100.0
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 100.0
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 100.0
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 100.0
2eue_A275 Carbon catabolite derepressing protein kinase; kin 100.0
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 100.0
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 100.0
3o0g_A292 Cell division protein kinase 5; kinase activator c 100.0
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 100.0
3niz_A311 Rhodanese family protein; structural genomics, str 100.0
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 100.0
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 100.0
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 100.0
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 100.0
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 100.0
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 100.0
3rp9_A458 Mitogen-activated protein kinase; structural genom 100.0
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 100.0
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 100.0
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 100.0
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 100.0
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 100.0
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 100.0
3bhy_A283 Death-associated protein kinase 3; death associate 100.0
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 100.0
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 100.0
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 100.0
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 100.0
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 100.0
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 100.0
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 100.0
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 100.0
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 100.0
3ork_A311 Serine/threonine protein kinase; structural genomi 100.0
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 100.0
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 100.0
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 100.0
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 100.0
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 100.0
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 100.0
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 100.0
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 100.0
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 100.0
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 100.0
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 100.0
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 100.0
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 100.0
3dls_A335 PAS domain-containing serine/threonine-protein KI; 100.0
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 100.0
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 100.0
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 100.0
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 100.0
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 100.0
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 100.0
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 100.0
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 100.0
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 100.0
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 100.0
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 100.0
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 100.0
2fst_X367 Mitogen-activated protein kinase 14; active mutant 100.0
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 100.0
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 100.0
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 100.0
3eqc_A360 Dual specificity mitogen-activated protein kinase; 100.0
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 100.0
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 100.0
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 100.0
3fme_A290 Dual specificity mitogen-activated protein kinase; 100.0
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 100.0
3an0_A340 Dual specificity mitogen-activated protein kinase; 100.0
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 100.0
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 100.0
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 100.0
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 100.0
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 100.0
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 100.0
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 100.0
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 100.0
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 100.0
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 100.0
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 100.0
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 100.0
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 100.0
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 100.0
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 100.0
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 100.0
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 100.0
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 100.0
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 100.0
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 100.0
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 100.0
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 100.0
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 100.0
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 100.0
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 100.0
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 100.0
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 100.0
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 100.0
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 100.0
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 100.0
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 100.0
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 100.0
2dyl_A318 Dual specificity mitogen-activated protein kinase 100.0
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 100.0
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 100.0
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 100.0
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 100.0
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 100.0
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 100.0
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 100.0
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 100.0
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 100.0
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 100.0
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 100.0
3aln_A327 Dual specificity mitogen-activated protein kinase; 100.0
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 100.0
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 100.0
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 100.0
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 100.0
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 100.0
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 100.0
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 100.0
3poz_A327 Epidermal growth factor receptor; kinase domain, a 100.0
2xir_A316 Vascular endothelial growth factor receptor 2; ang 100.0
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 100.0
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 100.0
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 100.0
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 100.0
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 100.0
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 100.0
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 100.0
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 100.0
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 100.0
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 100.0
2a19_B284 Interferon-induced, double-stranded RNA-activated 100.0
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 100.0
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 100.0
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 100.0
3soc_A322 Activin receptor type-2A; structural genomics cons 100.0
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 100.0
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 100.0
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 100.0
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 100.0
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 100.0
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 100.0
3lzb_A327 Epidermal growth factor receptor; epidermal growth 100.0
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 100.0
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 100.0
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 100.0
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 100.0
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 100.0
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 100.0
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 100.0
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 100.0
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 100.0
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 100.0
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 100.0
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 100.0
3pls_A298 Macrophage-stimulating protein receptor; protein k 100.0
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 100.0
3q4u_A301 Activin receptor type-1; structural genomics conso 100.0
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 100.0
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 100.0
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 100.0
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 100.0
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 100.0
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 100.0
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 100.0
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 100.0
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 100.0
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 100.0
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 100.0
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 100.0
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 100.0
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 100.0
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 100.0
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 100.0
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 100.0
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 100.0
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 100.0
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 100.0
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 100.0
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 100.0
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 100.0
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
3uqc_A286 Probable conserved transmembrane protein; structur 100.0
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 100.0
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 100.0
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.95
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.94
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.94
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.93
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.92
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.91
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.91
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.91
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.91
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.9
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.9
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.9
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.9
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.9
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.88
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.88
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.88
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.88
3fwb_A161 Cell division control protein 31; gene gating, com 99.88
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.88
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.88
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.87
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.87
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.87
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.87
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.87
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.87
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.87
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.87
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.87
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.86
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.86
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.86
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.85
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.85
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.85
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.85
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.85
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.85
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.85
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.84
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.84
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.84
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.84
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.83
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.83
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.83
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.83
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.83
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.83
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.82
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.82
1y1x_A191 Leishmania major homolog of programmed cell death 99.82
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.81
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.81
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.81
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.81
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.8
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.8
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.8
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.8
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.8
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.79
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.78
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.78
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.78
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.78
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.78
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.77
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.77
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.77
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.77
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.77
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.76
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.76
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.76
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.76
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.76
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.75
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.75
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.74
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.73
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.73
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.73
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.72
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.71
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.69
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.68
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 99.64
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.64
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 99.63
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.63
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.63
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.63
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.61
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.6
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.59
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.59
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.56
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.56
1y1x_A191 Leishmania major homolog of programmed cell death 99.55
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.54
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.53
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.53
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.51
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.5
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.48
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.45
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.45
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.44
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.42
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 99.4
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.4
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.38
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.37
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.37
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.36
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.35
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 99.34
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.34
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 99.34
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.34
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 99.31
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.3
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.29
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.28
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 99.27
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 99.26
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 99.26
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.25
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.25
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.23
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.23
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.21
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.21
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.21
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.21
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 99.2
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.19
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.19
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.19
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.18
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.17
1c07_A95 Protein (epidermal growth factor receptor pathway 99.17
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 99.17
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.17
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.17
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 99.16
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 99.15
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 99.15
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.14
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.14
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 99.13
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 99.13
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.12
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 99.12
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 99.12
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 99.12
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.11
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.11
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 99.11
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 99.11
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.11
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.11
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.1
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 99.1
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.1
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 99.1
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.09
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.09
2jq6_A139 EH domain-containing protein 1; metal binding prot 99.08
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.08
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.08
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.08
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.08
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.08
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.08
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.07
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 99.07
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 99.07
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.07
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.06
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.06
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.06
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.06
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.06
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.06
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.06
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.06
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 99.05
3li6_A66 Calcium-binding protein; calcium signaling protein 99.05
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 99.05
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 99.05
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 99.05
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.05
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 99.05
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 99.05
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 99.05
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 99.04
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.04
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.04
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.04
3fwb_A161 Cell division control protein 31; gene gating, com 99.04
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.04
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 99.04
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.04
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.03
1c07_A95 Protein (epidermal growth factor receptor pathway 99.03
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.03
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 99.02
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 99.02
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.02
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.02
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.02
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.01
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.01
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.01
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 99.0
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.0
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 99.0
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 99.0
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.0
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.99
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.99
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.99
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.99
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.99
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.98
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.98
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.98
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.97
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.97
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.97
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.97
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.96
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.96
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.96
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.96
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.96
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.96
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.96
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.96
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.96
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.96
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.96
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.95
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.94
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.94
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.94
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
Probab=100.00  E-value=7.4e-77  Score=662.35  Aligned_cols=445  Identities=37%  Similarity=0.636  Sum_probs=404.1

Q ss_pred             ccccccceeEeceecccCCeEEEEEEEcCCCcEEEEEEeeccccCChhhHHHHHHHHHHHHHhcCCCCeeEEEEEEEeCC
Q 006259          182 TGHLKEYYNLGRKLGNGQFGTTFLCMEKGTGKEYACKSIAKRKLIQKEDVEDVRREIQIMHHLAGHANAVLIKGAYEDSV  261 (653)
Q Consensus       182 ~~~~~~~y~i~~~LG~G~fG~Vy~~~~~~~g~~vAvK~i~~~~~~~~~~~~~~~~Ei~~l~~l~~hpnIv~l~~~~~~~~  261 (653)
                      ...+.++|++.+.||+|+||.||+|+++.+|+.||||++.+...........+.+|+.+|+++. ||||+++++++.+..
T Consensus        21 ~~~~~~~y~~~~~lg~G~~g~V~~~~~~~~~~~~avK~~~~~~~~~~~~~~~~~~E~~~l~~l~-hpniv~~~~~~~~~~   99 (484)
T 3nyv_A           21 TAIFSDRYKGQRVLGKGSFGEVILCKDKITGQECAVKVISKRQVKQKTDKESLLREVQLLKQLD-HPNIMKLYEFFEDKG   99 (484)
T ss_dssp             CCCHHHHEEEEEEEEEETTEEEEEEEETTTCCEEEEEEEETTTCCBSSCHHHHHHHHHHHTTCC-CTTBCCEEEEEECSS
T ss_pred             CCcccCceEEeeEEecCCCEEEEEEEECCCCCEEEEEEEEhhhcccchHHHHHHHHHHHHHhCC-CCCCCcEEEEEEeCC
Confidence            4456788999999999999999999999999999999998766554556788999999999997 999999999999999


Q ss_pred             eEEEEEeccCCCChHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHCCCeecCCCCCcEEEeeCCCCCCeEEeeccccccc
Q 006259          262 AVHVVMELCAGGELFDRIIKKGHYTERKAAQLARTIVGFVETSHSLGVMHRDLKPENFLFVNEHEDSPLKAIDFGLSTFF  341 (653)
Q Consensus       262 ~~~lV~E~~~ggsL~~~l~~~~~~~~~~~~~i~~qil~aL~~LH~~~iiHrDlKp~NILl~~~~~~~~iKL~DFGla~~~  341 (653)
                      .+|+|||||.|++|.+++...+.+++..++.++.||+.||.|||++||+||||||+|||+...+.++.+||+|||++...
T Consensus       100 ~~~lv~e~~~~~~L~~~~~~~~~~~~~~~~~i~~qi~~~l~~lH~~~ivH~Dlkp~Nil~~~~~~~~~~kl~Dfg~a~~~  179 (484)
T 3nyv_A          100 YFYLVGEVYTGGELFDEIISRKRFSEVDAARIIRQVLSGITYMHKNKIVHRDLKPENLLLESKSKDANIRIIDFGLSTHF  179 (484)
T ss_dssp             EEEEEECCCCSCBHHHHHHTCSCCBHHHHHHHHHHHHHHHHHHHHTTCCCSCCCGGGEEESSSSTTCCEEECCTTHHHHB
T ss_pred             EEEEEEecCCCCCHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHCCeeeCCCCHHHEEEecCCCCCcEEEEeeeeeEEc
Confidence            99999999999999999999889999999999999999999999999999999999999966566788999999999987


Q ss_pred             CCCCcccccccCCCCCChHHhhcCCCChhhhHHHHHHHHHHHhCCCCCCCCCHHHHHHHHHcCCCCCCCCCCcCCCHHHH
Q 006259          342 KPGDIFTDVVGSPYYVSPEVLLKHYGPEADVWSAGVIIYILLSGVPPFWGETEHDIFEEVLHGDLDLSSDPWPKISENAK  421 (653)
Q Consensus       342 ~~~~~~~~~~gt~~Y~APE~l~~~~~~~~DIwSlGvil~eLltg~~Pf~~~~~~~~~~~i~~~~~~~~~~~~~~~s~~l~  421 (653)
                      .........+||+.|+|||++.+.|+.++|||||||++|+|++|.+||.+.+..+++..+..+...+....|..+++.++
T Consensus       180 ~~~~~~~~~~gt~~y~aPE~~~~~~~~~~DiwslG~il~~ll~g~~pf~~~~~~~~~~~i~~~~~~~~~~~~~~~s~~~~  259 (484)
T 3nyv_A          180 EASKKMKDKIGTAYYIAPEVLHGTYDEKCDVWSTGVILYILLSGCPPFNGANEYDILKKVEKGKYTFELPQWKKVSESAK  259 (484)
T ss_dssp             CCCCSHHHHTTGGGTCCHHHHHTCCCTHHHHHHHHHHHHHHHHSSCSSCCSSHHHHHHHHHHCCCCCCSGGGGGSCHHHH
T ss_pred             ccccccccCCCCccccCceeecCCCCCcceeHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHcCCCCCCCcccccCCHHHH
Confidence            76666677789999999999998999999999999999999999999999999999999999988888788889999999


Q ss_pred             HHHHHhccCCCCCCCCHHHHhcCCcccccCC---CCCCCchhHHHHhhhhhhhHHHHHHHHHHhhhhch-hhHHHhhhHh
Q 006259          422 DLVRKMLVRDPRKRLTAHEVLCHPWFQIDGG---APDKPLDSAVLSRLKQFSAMNKLKKMALRVIAESL-SEEEIAGLKE  497 (653)
Q Consensus       422 ~li~~~L~~dP~~Rpt~~elL~hp~f~~~~~---~~~~~~~~~~l~~~~~~~~~~~lk~~~~~~~~~~~-s~~~~~~i~~  497 (653)
                      +||.+||+.||.+|||+.++|+||||+....   ..+.+.....+.++++|...+++++.++.+++..+ +++++.++++
T Consensus       260 ~li~~~L~~dp~~R~s~~e~l~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kl~qa~l~~i~~~~~~~~~~~~l~~  339 (484)
T 3nyv_A          260 DLIRKMLTYVPSMRISARDALDHEWIQTYTKEQISVDVPSLDNAILNIRQFQGTQKLAQAALLYMGSKLTSQDETKELTA  339 (484)
T ss_dssp             HHHHHHTCSSGGGSCCHHHHHTSHHHHHHTC-----CCCBCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHCCCChhHCcCHHHHhhChhhcccccccccccccchHHHHHHHHHHhhhhHHHHHHHHHHHhccCcHHHHHHHHH
Confidence            9999999999999999999999999986443   22445566778899999999999999999998876 7889999999


Q ss_pred             hhhhcccCCCCcccHHHH----HHHHHhcCCCCC-------HHHHHHHHHhccCCCCCceecchhhhHHhhhhhhhhhHH
Q 006259          498 MFKALDADNSGFITFEEL----KVGLKRFGASLD-------ESEIYDLMQAADVDNSGTIDYGEFIAATLHLNKAQREDH  566 (653)
Q Consensus       498 ~F~~~D~d~dG~Is~~el----~~~l~~~g~~~~-------~~ei~~l~~~~D~d~dg~I~~~EFi~~~~~~~~~~~~~~  566 (653)
                      +|+.+|.|+||+|+.+||    ..+++.+|.+++       +.++..+|..+|.|++|.|+|+||+.++........++.
T Consensus       340 ~F~~~D~d~dG~I~~~El~~~l~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~D~d~~g~i~~~Ef~~~~~~~~~~~~~~~  419 (484)
T 3nyv_A          340 IFHKMDKNGDGQLDRAELIEGYKELMRMKGQDASMLDASAVEHEVDQVLDAVDFDKNGYIEYSEFVTVAMDRKTLLSRER  419 (484)
T ss_dssp             HHHHHCTTCSSEEEHHHHHHHHHHHHC----CGGGCSHHHHHHHHHHHHHHHTCCTTSEEEHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHhCcCCCceEeHHHHHHHHHHHhhhcccccccccccccHHHHHHHHHHhCCCCCCeEeHHHHHHHHHhccccCcHHH
Confidence            999999999999999999    445555677777       788999999999999999999999999877766677788


Q ss_pred             HHHHhcccCcCCCCcccHHHHHHHHHHcCCCHHHHHHHHHHhcCCCCCcccHHHHHHHHHc
Q 006259          567 LFAAFSYFDKDGSGYITADELQQACDEFGIEDMRLEDLIREVDQDNDGRIDYNEFVAMMHN  627 (653)
Q Consensus       567 l~~aF~~~D~d~~G~I~~~el~~~l~~~g~~~~~~~~~~~~~D~d~dG~Is~~EF~~~~~~  627 (653)
                      +..+|+.||+|++|+|+.+||+.++...++++++++++|..+|.|+||.|+|+||+++|..
T Consensus       420 ~~~~F~~~D~d~dG~I~~~El~~~l~~~~~~~~~~~~~~~~~D~d~dG~i~~~Ef~~~~~~  480 (484)
T 3nyv_A          420 LERAFRMFDSDNSGKISSTELATIFGVSDVDSETWKSVLSEVDKNNDGEVDFDEFQQMLLK  480 (484)
T ss_dssp             HHHHHHHHCTTCCSEEEHHHHHHHHHHTTCCHHHHHHHHHHHCTTCCSEEEHHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCCcCCHHHHHHHHHhcCCCHHHHHHHHHHhcCCCCCcCCHHHHHHHHHh
Confidence            9999999999999999999999999988899999999999999999999999999999986



>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 653
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 3e-89
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 7e-84
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 3e-82
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 3e-82
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 6e-80
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 8e-78
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 1e-77
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 9e-76
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 3e-75
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 3e-74
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 3e-74
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 7e-73
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 9e-73
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 2e-71
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 2e-69
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 5e-67
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 4e-66
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 1e-65
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 9e-65
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 1e-63
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 1e-63
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-63
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 2e-60
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 1e-59
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 1e-59
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 2e-59
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 2e-59
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 5e-59
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 6e-58
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 3e-57
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 5e-57
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 7e-57
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 2e-56
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 5e-56
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 1e-54
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 2e-54
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 1e-53
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 2e-53
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 3e-53
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 4e-53
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 5e-53
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 2e-50
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 2e-50
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 3e-50
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 4e-50
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-49
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 1e-48
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 2e-48
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 2e-48
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 5e-48
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 6e-48
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 1e-47
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 4e-47
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 2e-46
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 4e-46
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 5e-46
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 2e-43
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 9e-43
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 9e-42
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 2e-41
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 2e-39
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 5e-38
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 5e-32
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 3e-06
d1s6ia_182 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 2e-31
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 3e-31
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 2e-30
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 2e-08
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 9e-30
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 3e-29
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 6e-29
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 3e-28
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 1e-04
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 1e-26
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 2e-06
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 5e-26
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.004
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 1e-25
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 1e-11
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 1e-24
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 8e-15
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 3e-11
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 2e-07
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 4e-24
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 9e-08
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 4e-24
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 2e-12
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 7e-24
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 7e-24
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 3e-08
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 2e-23
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 2e-11
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 3e-23
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 4e-08
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 4e-06
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 2e-04
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 3e-23
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 4e-17
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 4e-23
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 2e-04
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 4e-23
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 8e-07
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 1e-22
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 1e-13
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 3e-22
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 2e-21
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 4e-11
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 8e-04
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 5e-21
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 9e-21
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 7e-15
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 5e-14
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 1e-08
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 1e-20
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 4e-07
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 2e-20
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 6e-13
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 2e-08
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 2e-20
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 4e-20
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 3e-11
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 1e-08
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 2e-19
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 5e-05
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 0.004
d1wdcb_142 a.39.1.5 (B:) Myosin Essential Chain {Bay scallop 7e-19
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 3e-18
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 5e-15
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 0.004
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 3e-18
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 7e-04
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 8e-18
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-13
d1wdcc_152 a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop 2e-17
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 3e-17
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 4e-13
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 1e-05
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 3e-17
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 1e-14
d1alva_173 a.39.1.8 (A:) Calpain small (regulatory) subunit ( 3e-17
d1alva_173 a.39.1.8 (A:) Calpain small (regulatory) subunit ( 8e-13
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 4e-17
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 4e-15
d1ggwa_140 a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo 4e-17
d1ggwa_140 a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo 0.002
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 6e-17
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 6e-13
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 8e-17
d1auib_165 a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch 4e-16
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 5e-16
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-15
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 7e-16
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 5e-14
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 3e-15
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 2e-14
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 4e-15
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 1e-13
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 2e-06
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 4e-15
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 5e-14
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 6e-15
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 1e-14
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 2e-08
d1ij5a_ 321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 1e-06
d1yuta198 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa 6e-15
d1yuta198 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa 2e-10
d1qjta_99 a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 2e-13
d1qjta_99 a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 1e-06
d1hqva_181 a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous 3e-13
d1hqva_181 a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous 2e-07
d1hqva_181 a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous 2e-04
d1qx2a_76 a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax 5e-13
d1qx2a_76 a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax 4e-11
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 7e-13
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 1e-12
d2zkmx1170 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human 8e-13
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 2e-12
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 1e-10
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 2e-12
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 4e-10
d1xk4a187 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa 2e-12
d1xk4a187 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa 5e-08
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 3e-12
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 1e-10
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 3e-12
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 9e-12
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 7e-04
d1zfsa193 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no 1e-11
d1zfsa193 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no 1e-09
d1k8ua_89 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 2e-11
d1k8ua_89 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 1e-05
d1y1xa_182 a.39.1.8 (A:) Programmed cell death 6 protein-like 2e-11
d1y1xa_182 a.39.1.8 (A:) Programmed cell death 6 protein-like 5e-06
d1y1xa_182 a.39.1.8 (A:) Programmed cell death 6 protein-like 2e-04
d1ksoa_93 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 3e-11
d1ksoa_93 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 8e-08
d2jxca195 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ 5e-11
d2jxca195 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ 2e-10
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 8e-11
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 3e-10
d1fi6a_92 a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 8e-11
d1fi6a_92 a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 9e-11
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 9e-11
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 4e-10
d1iq3a_110 a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9 3e-10
d1iq3a_110 a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9 6e-08
d1psra_100 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 4e-09
d1psra_100 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 5e-08
d1e8aa_87 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 1e-08
d1e8aa_87 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 2e-05
d2hf5a133 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapien 2e-06
d2hf5a133 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapien 7e-05
d2pula1392 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK { 2e-05
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Calmodulin-dependent protein kinase
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score =  278 bits (711), Expect = 3e-89
 Identities = 120/298 (40%), Positives = 175/298 (58%), Gaps = 5/298 (1%)

Query: 181 KTGHLKEYYNLGRKLGNGQFGTTFLCMEKGTGKEYACKSIAKRKLIQKEDVEDVRREIQI 240
           +   +++ Y+    LG G F    L  +K T K  A K IAK+ L  KE    +  EI +
Sbjct: 3   QAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKALEGKE--GSMENEIAV 60

Query: 241 MHHLAGHANAVLIKGAYEDSVAVHVVMELCAGGELFDRIIKKGHYTERKAAQLARTIVGF 300
           +H +  H N V +   YE    ++++M+L +GGELFDRI++KG YTER A++L   ++  
Sbjct: 61  LHKIK-HPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDA 119

Query: 301 VETSHSLGVMHRDLKPENFLFVNEHEDSPLKAIDFGLSTFFKPGDIFTDVVGSPYYVSPE 360
           V+  H LG++HRDLKPEN L+ +  EDS +   DFGLS    PG + +   G+P YV+PE
Sbjct: 120 VKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPE 179

Query: 361 VLL-KHYGPEADVWSAGVIIYILLSGVPPFWGETEHDIFEEVLHGDLDLSSDPWPKISEN 419
           VL  K Y    D WS GVI YILL G PPF+ E +  +FE++L  + +  S  W  IS++
Sbjct: 180 VLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDS 239

Query: 420 AKDLVRKMLVRDPRKRLTAHEVLCHPWFQIDGGAPDKPLDSAVLSRLKQFSAMNKLKK 477
           AKD +R ++ +DP KR T  + L HPW   D  A DK +  +V  ++K+  A +K K+
Sbjct: 240 AKDFIRHLMEKDPEKRFTCEQALQHPWIAGD-TALDKNIHQSVSEQIKKNFAKSKWKQ 296


>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 152 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Length = 392 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query653
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.91
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.89
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.89
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.88
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.87
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.87
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.87
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.86
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.86
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.86
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.85
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.84
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.83
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.83
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.81
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.8
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.8
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.79
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.78
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.78
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.77
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.75
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.74
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.74
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.74
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.74
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.72
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.72
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.72
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.72
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.71
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.71
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.7
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.69
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.68
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.68
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.66
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.59
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.58
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.51
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.45
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.43
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.42
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.41
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.39
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.39
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.39
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.38
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.38
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.37
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.36
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.35
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.34
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.33
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.33
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.33
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.33
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.33
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.33
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.32
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.31
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.3
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.29
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.29
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.29
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.28
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.2
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 99.19
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.18
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.17
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.17
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.16
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.14
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.14
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.13
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 99.11
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.1
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.09
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.09
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 99.04
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.99
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.99
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.98
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.96
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.95
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 98.95
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.95
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.95
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.94
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.94
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.93
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.93
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.91
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.91
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.91
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.91
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.9
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.89
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.88
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.87
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.87
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.87
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.86
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 98.85
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.83
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.83
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.82
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.82
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.82
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.8
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.79
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.78
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.78
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.77
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.75
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.74
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.74
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.73
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.73
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.7
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.67
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.67
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.66
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.66
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.65
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.65
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.64
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.64
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.63
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.63
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.63
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.59
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.58
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.58
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.57
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.56
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.56
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.54
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.49
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.49
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.48
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 98.43
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.43
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 98.29
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.27
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.23
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.2
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 98.16
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.1
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 98.04
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.02
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.87
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.84
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.84
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.81
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.75
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 97.71
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 97.65
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.59
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 97.28
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 96.8
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 96.53
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 96.44
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 95.54
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 95.13
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 94.61
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 93.67
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 91.45
d1eg3a1125 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 87.95
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 87.15
d1pula1103 Hypothetical protein c32e8.3 {Caenorhabditis elega 84.08
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 82.0
d1pula1103 Hypothetical protein c32e8.3 {Caenorhabditis elega 81.39
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Calmodulin-dependent protein kinase
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00  E-value=1.2e-60  Score=497.33  Aligned_cols=286  Identities=40%  Similarity=0.734  Sum_probs=234.9

Q ss_pred             ccccccceeEeceecccCCeEEEEEEEcCCCcEEEEEEeeccccCChhhHHHHHHHHHHHHHhcCCCCeeEEEEEEEeCC
Q 006259          182 TGHLKEYYNLGRKLGNGQFGTTFLCMEKGTGKEYACKSIAKRKLIQKEDVEDVRREIQIMHHLAGHANAVLIKGAYEDSV  261 (653)
Q Consensus       182 ~~~~~~~y~i~~~LG~G~fG~Vy~~~~~~~g~~vAvK~i~~~~~~~~~~~~~~~~Ei~~l~~l~~hpnIv~l~~~~~~~~  261 (653)
                      .+.+++.|++++.||+|+||+||+|+++.+|+.||||++.+....  .....+.+|+.+|+++. |||||++++++.+.+
T Consensus         4 ~edi~d~Y~~~~~lG~G~fg~Vy~~~~~~~~~~vAvK~i~~~~~~--~~~~~~~~Ei~il~~l~-HpnIv~l~~~~~~~~   80 (307)
T d1a06a_           4 AEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKALE--GKEGSMENEIAVLHKIK-HPNIVALDDIYESGG   80 (307)
T ss_dssp             CSCGGGTEEEEEESBSGGGGGEEEEEETTTCCEEEEEEEEC------------CHHHHHHHTCC-CTTBCCEEEEEECSS
T ss_pred             CCCCccceEEEEEEeeccCeEEEEEEECCCCCEEEEEEEchHHhh--hHHHHHHHHHHHHHhCC-CCCCCcEEEEEEECC
Confidence            346778899999999999999999999999999999999876532  23456889999999997 999999999999999


Q ss_pred             eEEEEEeccCCCChHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHCCCeecCCCCCcEEEeeCCCCCCeEEeeccccccc
Q 006259          262 AVHVVMELCAGGELFDRIIKKGHYTERKAAQLARTIVGFVETSHSLGVMHRDLKPENFLFVNEHEDSPLKAIDFGLSTFF  341 (653)
Q Consensus       262 ~~~lV~E~~~ggsL~~~l~~~~~~~~~~~~~i~~qil~aL~~LH~~~iiHrDlKp~NILl~~~~~~~~iKL~DFGla~~~  341 (653)
                      .+|||||||+||+|.+++...+.+++..++.++.||+.||.|||++||+||||||+|||+...+.++.+||+|||+|+..
T Consensus        81 ~~~lvmE~~~gg~L~~~l~~~~~l~e~~~~~~~~qi~~al~ylH~~~iiHrDiKp~Nil~~~~~~~~~vkl~DFG~a~~~  160 (307)
T d1a06a_          81 HLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKME  160 (307)
T ss_dssp             EEEEEECCCCSCBHHHHHHTCSCCCHHHHHHHHHHHHHHHHHHHHTTCCCSCCCGGGEEESSSSTTCCEEECCC------
T ss_pred             EEEEEEeccCCCcHHHhhhcccCCCHHHHHHHHHHHHHHHHhhhhceeeeEEecccceeecccCCCceEEEeccceeEEc
Confidence            99999999999999999999889999999999999999999999999999999999999976667889999999999987


Q ss_pred             CCCCcccccccCCCCCChHHhhc-CCCChhhhHHHHHHHHHHHhCCCCCCCCCHHHHHHHHHcCCCCCCCCCCcCCCHHH
Q 006259          342 KPGDIFTDVVGSPYYVSPEVLLK-HYGPEADVWSAGVIIYILLSGVPPFWGETEHDIFEEVLHGDLDLSSDPWPKISENA  420 (653)
Q Consensus       342 ~~~~~~~~~~gt~~Y~APE~l~~-~~~~~~DIwSlGvil~eLltg~~Pf~~~~~~~~~~~i~~~~~~~~~~~~~~~s~~l  420 (653)
                      .........+||+.|||||++.+ .|+.++|||||||++|+|++|++||.+....++...+..+...+....++.+|+++
T Consensus       161 ~~~~~~~~~~GT~~y~APE~~~~~~~~~~~DiwSlGvilyell~g~~Pf~~~~~~~~~~~i~~~~~~~~~~~~~~~s~~~  240 (307)
T d1a06a_         161 DPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSA  240 (307)
T ss_dssp             ------------CTTSCHHHHTTCCCCTHHHHHHHHHHHHHHHHSSCSCCCSSHHHHHHHHHTTCCCCCTTTTTTSCHHH
T ss_pred             cCCCeeeeeeeCccccCcHHHcCCCCCcHHHhhhhhHHHHHHHhCCCCCCCCCHHHHHHHHhccCCCCCCccccCCCHHH
Confidence            76666777899999999999984 59999999999999999999999999999999999999998888877778899999


Q ss_pred             HHHHHHhccCCCCCCCCHHHHhcCCcccccCCCCCCCchhHHHHhhhhhhh
Q 006259          421 KDLVRKMLVRDPRKRLTAHEVLCHPWFQIDGGAPDKPLDSAVLSRLKQFSA  471 (653)
Q Consensus       421 ~~li~~~L~~dP~~Rpt~~elL~hp~f~~~~~~~~~~~~~~~l~~~~~~~~  471 (653)
                      ++||.+||++||.+|||+.|+|+||||+... ...+.....+..+++++..
T Consensus       241 ~~li~~~L~~dP~~R~s~~eil~hp~~~~~~-~~~~~~~~~~~~~~~~~~~  290 (307)
T d1a06a_         241 KDFIRHLMEKDPEKRFTCEQALQHPWIAGDT-ALDKNIHQSVSEQIKKNFA  290 (307)
T ss_dssp             HHHHHHHSCSSGGGSCCHHHHHHSTTTTSSC-CCCCCCHHHHHHHHHHHSC
T ss_pred             HHHHHHHccCCHhHCcCHHHHhcCHhhCCCC-ccccccchhHHHHHHHHHH
Confidence            9999999999999999999999999998543 3334445555555554433



>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1eg3a1 a.39.1.7 (A:85-209) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure