Citrus Sinensis ID: 006277


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650--
MVRQKWSLLILMYLRLIQLVDTSGYKAFDEVNGLEVAWCQVRIDDVLQSPEDLERLYSEVHLLKSLKHNNIIRFYNSWIDDQNKTVNIITELFTSGSLRQYRKKHKKVDMKAVKGWARQILSGLIYLHSHDPPIIHRDLKCDNIFINGNQGEVKIGDLGLATIMEQANAKSVIGTPEFMAPELYDENYNELADIYSFGMCMLEMVTFEYPYSECRNSAQIYKKVSSGIKPAALSKVKDPEVKSFIEKCLVPASQRLSAKELLMDPFLQVNGTTKNRPLPLPDIVLPRVGAFGDRCLMSEGPASVRNKHPSMDFDSDAELPVITSLDNSGGGDSYSPSIEVRRSKRGNFFLLKGESNDEYSVSLILRIADQSGRLRNIHFLFYLDSDTAFSVSSEMVEQLELADQNVTFIAELIDLLLLNLIPGWKPCVRIDHLIPQKSRRQSPEDHEKDALSLERVDNSSGLSHRSYEADNHSRSSDGQDSTSLKEGIQTTVLGPDFMKPDEKRSHNDFSCQGKATADDQTSEKSNVSASSSEQNEKKYCFSSDIFPEPGTMDFDGHAFVVRTSESPARMGLGETPDEKSNIMDICSNGVVDTSSGLTISSLSDLEIDEEIRMKLEMIDLQYQEEFKAISKRRHDAILDTKKSMKKKTEPVY
ccccccHHHHHHHHHHccEEccEEEEEECccccCEEEEEEEEEccccccHHHHHHHHHHHHHHHHccccccEEEEEEEECccccEEEEEEEEEccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEcccccCEEEEccHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHccccccccccccccHHHHHHHHHHcccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccCEEEccccccccccEEEEEEccccccEEEEEEccccccccccccHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
****KWSLLILMYLRLIQLVDTSGYKAFDEVNGLEVAWCQVRIDDVLQSPEDLERLYSEVHLLKSLKHNNIIRFYNSWIDDQNKTVNIITELFTSGSLRQYRKKHKKVDMKAVKGWARQILSGLIYLHSHDPPIIHRDLKCDNIFINGNQGEVKIGDLGLATIMEQANAKSVIGTPEFMAPELYDENYNELADIYSFGMCMLEMVTFEYPYSECRNSAQIYKKVSSGIKPAALSKVKDPEVKSFIEKCLVPASQRLSAKELLMDPFLQVNGTTKNRPLPLPDIVLPRVGAFGDRCL**************************************************NFFLLKGESNDEYSVSLILRIADQSGRLRNIHFLFYLDSDTAFSVSSEMVEQLELADQNVTFIAELIDLLLLNLIPGWKPCV******************************************************************************************************************SD******TMDFD***************************MDICSNGVVDTSSGLTISSLSDLEIDEEIRMKLEMIDLQYQEEFKA************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRQKWSLLILMYLRLIQLVDTSGYKAFDEVNGLEVAWCQVRIDDVLQSPEDLERLYSEVHLLKSLKHNNIIRFYNSWIDDQNKTVNIITELFTSGSLRQYRKKHKKVDMKAVKGWARQILSGLIYLHSHDPPIIHRDLKCDNIFINGNQGEVKIGDLGLATIMEQANAKSVIGTPEFMAPELYDENYNELADIYSFGMCMLEMVTFEYPYSECRNSAQIYKKVSSGIKPAALSKVKDPEVKSFIEKCLVPASQRLSAKELLMDPFLQVNGTTKNRPLPLPDIVLPRVGAFGDRCLMSEGPASVRNKHPSMDFDSDAELPVITSLDNSGGGDSYSPSIEVRRSKRGNFFLLKGESNDEYSVSLILRIADQSGRLRNIHFLFYLDSDTAFSVSSEMVEQLELADQNVTFIAELIDLLLLNLIPGWKPCVRIDHLIPQKSRRQSPEDHEKDALSLERVDNSSGLSHRSYEADNHSRSSDGQDSTSLKEGIQTTVLGPDFMKPDEKRSHNDFSCQGKATADDQTSEKSNVSASSSEQNEKKYCFSSDIFPEPGTMDFDGHAFVVRTSESPARMGLGETPDEKSNIMDICSNGVVDTSSGLTISSLSDLEIDEEIRMKLEMIDLQYQEEFKAISKRRHDAILDTKKSMKKKTEPVY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable serine/threonine-protein kinase WNK7 May regulate flowering time by modulating the photoperiod pathway.probableQ8LST2

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3Q5I, chain A
Confidence level:very confident
Coverage over the Query: 13-317,337-399
View the alignment between query and template
View the model in PyMOL
Template: 2LRU, chain A
Confidence level:probable
Coverage over the Query: 358-420
View the alignment between query and template
View the model in PyMOL