BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 006322
(650 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3P23|A Chain A, Crystal Structure Of The Human Kinase And Rnase Domains In
Complex With Adp
pdb|3P23|B Chain B, Crystal Structure Of The Human Kinase And Rnase Domains In
Complex With Adp
pdb|3P23|C Chain C, Crystal Structure Of The Human Kinase And Rnase Domains In
Complex With Adp
pdb|3P23|D Chain D, Crystal Structure Of The Human Kinase And Rnase Domains In
Complex With Adp
Length = 432
Score = 29.6 bits (65), Expect = 6.0, Method: Compositional matrix adjust.
Identities = 29/99 (29%), Positives = 42/99 (42%), Gaps = 10/99 (10%)
Query: 387 FMMSQVDLAREAAHLSRFIYNFRRWKDVSFPKPVYPLVHPAVLVETYEQGECVSRYVDEL 446
F +V L RE+ I F KD F L A L E EQ + ++ +
Sbjct: 63 FADREVQLLRESDEHPNVIRYFCTEKDRQFQYIAIELC-AATLQEYVEQKDFAHLGLEPI 121
Query: 447 QGHERLKSALAHIGTHALLKMLLVDNFIHADMHPGNILV 485
++ S LAH+ H+L N +H D+ P NIL+
Sbjct: 122 TLLQQTTSGLAHL--HSL-------NIVHRDLKPHNILI 151
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.326 0.137 0.426
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 18,145,344
Number of Sequences: 62578
Number of extensions: 699716
Number of successful extensions: 2408
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 2407
Number of HSP's gapped (non-prelim): 3
length of query: 650
length of database: 14,973,337
effective HSP length: 105
effective length of query: 545
effective length of database: 8,402,647
effective search space: 4579442615
effective search space used: 4579442615
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 55 (25.8 bits)