BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 006322
         (650 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3P23|A Chain A, Crystal Structure Of The Human Kinase And Rnase Domains In
           Complex With Adp
 pdb|3P23|B Chain B, Crystal Structure Of The Human Kinase And Rnase Domains In
           Complex With Adp
 pdb|3P23|C Chain C, Crystal Structure Of The Human Kinase And Rnase Domains In
           Complex With Adp
 pdb|3P23|D Chain D, Crystal Structure Of The Human Kinase And Rnase Domains In
           Complex With Adp
          Length = 432

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 42/99 (42%), Gaps = 10/99 (10%)

Query: 387 FMMSQVDLAREAAHLSRFIYNFRRWKDVSFPKPVYPLVHPAVLVETYEQGECVSRYVDEL 446
           F   +V L RE+      I  F   KD  F      L   A L E  EQ +     ++ +
Sbjct: 63  FADREVQLLRESDEHPNVIRYFCTEKDRQFQYIAIELC-AATLQEYVEQKDFAHLGLEPI 121

Query: 447 QGHERLKSALAHIGTHALLKMLLVDNFIHADMHPGNILV 485
              ++  S LAH+  H+L       N +H D+ P NIL+
Sbjct: 122 TLLQQTTSGLAHL--HSL-------NIVHRDLKPHNILI 151


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.137    0.426 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 18,145,344
Number of Sequences: 62578
Number of extensions: 699716
Number of successful extensions: 2408
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 2407
Number of HSP's gapped (non-prelim): 3
length of query: 650
length of database: 14,973,337
effective HSP length: 105
effective length of query: 545
effective length of database: 8,402,647
effective search space: 4579442615
effective search space used: 4579442615
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 55 (25.8 bits)