Citrus Sinensis ID: 006335


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650
MEKPVSSTSLARTKSDQLVETLSAAFKSPVSSETAGASDGGGTLSRKSSRRMLTAASPGRAGASGRNTHIRKSRSAQLKLELDEVSSGAALSRASSASLGLSFSFTGFTMPPDEIADSKPFSDDDIPEDIEAGTRERPKFQTEPTLPIYLKFTDVTYKVILKGMTSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGNLHDVSVPSELQDRVQTENSENDTANGKPTPAIVHEYLVEAYETRVAENEKKKLMAPIPLDEEIKAKVSSPKRNWGASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQSDSKSPKGLEDQAGLLFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPLNLVLPVLFLVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQVCPFITTDKINHT
ccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccHHHHHccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEccccccccccccccccEEEEcccEEEEEccccccHHHHHHHHHcccccccEEEEEEEccccccccccccEEEEEEcccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHcccEEEEccccEEEEcccccHHHHHHHccccccccccHHHHHHHHHcccccccccccHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccc
ccccccccccEEccHHHHHHHHHHHHccccccHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccEEEccccccccccccHHcccccccccccEEEccccEEEEEEEEEEEEEcccccccccEEcEEEEEEEEccccEEEEEccccccHHHHHHHHcccccccEEEEEEEEcccccccccEEEEEEEEccccccccEEEHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHcccccccccccccccEEEEEEHEEEccccEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHcccccccccccHHHHHHHccccccHccccccccccccccHHHHHHccccccHHHHHHHHHHHHHHcHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccHHHHHHHcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
mekpvsstslartkSDQLVETLSAAfkspvssetagasdgggtlsrksSRRMLtaaspgragasgrnthiRKSRSAQLKLELDevssgaalsrassaslglsfsftgftmppdeiadskpfsdddipedieagtrerpkfqteptlpiylkftDVTYKVILKGMTSSEEKDILngitgsvnpgevlalmgpsgsgkTTLLNLLSgrlmeptvggsityndhpyskslkskigfvtqddvlfphltvKETLTYAALLRLPNTLTKQQKEKRAIDVINELGlercqdtmiggsfvrgvsggerkrvcigneiiinpsllfldeptsgldstTALRIVQMLQDIAEAGKTVVTtihqpssrlfhkFDKLILlgkgsllyfgKASEAMAYFssigcspqiamnpAEFLLDLangnlhdvsvpselqdrvqtensendtangkptpAIVHEYLVEAYETRVAENEkkklmapipldeeikakvsspkrnwgasWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLwwqsdskspkgledQAGLLFFIAVFWSFfpiftaiftfpQERAMLSKERAADMYRLSAYFLARttsdlplnlvlPVLFLVIVYFMAGlrmgagpfFLSMLTVFLSIVAAQvcpfittdkinht
mekpvsstslartksdqLVETLSaafkspvssetagasdgggtlsrkssrRMLTaaspgragasgrnthirkSRSAQLKLELDEVSSGAALSRASSASLGLSFSFTGFTMPPDEIADSKPFSDDDIPEDIEagtrerpkfqteptlpiylkftDVTYKVILKGMTSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQDDVLFPHLTVKETLTYAALLRlpntltkqqkekrAIDVINELglercqdtmiggsfvrgvsggERKRVCIGNEIiinpsllfldEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTihqpssrlfhKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGNLHDVSVPSELQDRVQTEnsendtangkptpAIVHEYLVEAYETRVAEnekkklmapipldeeikakvsspkrnwgaswIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQSDSKSPKGLEDQAGLLFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPLNLVLPVLFLVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQVCPFIttdkinht
MEKPVSSTSLARTKSDQLVETLSAAFKSPVSSETAGASDGGGTLSRKSSRRMLTaaspgragasgrNTHIRKSRSAQLKLELDEVssgaalsrassaslglsfsftgfTMPPDEIADSKPFSDDDIPEDIEAGTRERPKFQTEPTLPIYLKFTDVTYKVILKGMTSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGNLHDVSVPSELQDRVQTENSENDTANGKPTPAIVHEYLVEAYETRVAENEKKKLMAPIPLDEEIKAKVSSPKRNWGASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQSDSKSPKGLEDQAGLLFFIAVFWSffpiftaiftfpQERAMLSKERAADMYRLSAYFLARTTSDlplnlvlpvlflvivYFMAGLRMGAGPFFLSMLTVFLSIVAAQVCPFITTDKINHT
************************************************************************************************************************************************TLPIYLKFTDVTYKVILKGMTSS*EKDILNGITGSVNPGEVLALMG****GKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGNLHD***************************AIVHEYLVEAYETRVA*************************RNWGASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQS*******LEDQAGLLFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPLNLVLPVLFLVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQVCPFITTD*****
**************************************************************************************************************************************************PIYLKFTDVTYKVILK********DILNGITGSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGNLHDVS*************************AIVHEYLVEA**********************************GASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQSDSKSPKGLEDQAGLLFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPLNLVLPVLFLVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQVCPFITTDKINHT
*************KSDQLVETLSAA*************************************************SAQLKLELDEVSSGAALSRASSASLGLSFSFTGFTMPPDEIADSKPFSDDDIPEDIEAGTRERPKFQTEPTLPIYLKFTDVTYKVILKGMTSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGNLHDVSVPSELQ*************NGKPTPAIVHEYLVEAYETRVAENEKKKLMAPIPLDEEIKAKVSSPKRNWGASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQSDSKSPKGLEDQAGLLFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPLNLVLPVLFLVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQVCPFITTDKINHT
*************K**QLVETLSAAFK*************************************GRNTHIRKSRSAQLKLELDEVSSGAALSRASSASLGLSFSFTGFTMPPDEIADSKPFSDDDIPEDIEAGTRERPKFQTEPTLPIYLKFTDVTYKVILKGMTSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGNLHDVSVPSELQDRVQTENSENDTANGKPTPAIVHEYLVEAYETRVAENEKKKLMAPIPLDEEIKAKVSSPKRNWGASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQSDSKSPKGLEDQAGLLFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPLNLVLPVLFLVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQVCPFITTDKIN**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKPVSSTSLARTKSDQLVETLSAAFKSPVSSETAGASDGGGTLSRKSSRRMLTAASPGRAGASGRNTHIRKSRSAQLKLELDEVSSGAALSRASSASLGLSFSFTGFTMPPDEIADSKPFSDDDIPEDIEAGTRERPKFQTEPTLPIYLKFTDVTYKVILKGMTSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGNLHDVSVPSELQDRVQTENSENDTANGKPTPAIVHEYLVEAYETRVAENEKKKLMAPIPLDEEIKAKVSSPKRNWGASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQSDSKSPKGLEDQAGLLFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPLNLVLPVLFLVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQVCPFITTDKINHT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query650 2.2.26 [Sep-21-2011]
Q93YS4751 ABC transporter G family yes no 0.973 0.842 0.770 0.0
Q9FT51737 ABC transporter G family no no 0.956 0.843 0.688 0.0
Q9SZR9 638 ABC transporter G family no no 0.695 0.708 0.514 1e-136
Q9LK50 685 ABC transporter G family no no 0.74 0.702 0.485 1e-134
Q9C6W5 648 ABC transporter G family no no 0.703 0.705 0.509 1e-133
Q84TH5 662 ABC transporter G family no no 0.712 0.699 0.464 1e-127
Q7XA72 672 ABC transporter G family no no 0.769 0.744 0.450 1e-124
Q7TMS5 657 ATP-binding cassette sub- yes no 0.726 0.718 0.355 2e-77
Q4GZT4 655 ATP-binding cassette sub- yes no 0.733 0.728 0.355 2e-76
Q9UNQ0 655 ATP-binding cassette sub- yes no 0.732 0.726 0.357 3e-76
>sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 Back     alignment and function desciption
 Score =  992 bits (2565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/646 (77%), Positives = 563/646 (87%), Gaps = 13/646 (2%)

Query: 1   MEKPVSSTSLARTKSDQLVETLSAAFKSPVSSETA--------GASDGGGTLSRKSSRRM 52
           MEKP  ++ LART+S+QL ET++A  +SP  S  A         A  GGGTLSRKSSRR+
Sbjct: 3   MEKPPLASGLARTRSEQLYETVAADIRSPHGSMDANGVPATAPAAVGGGGTLSRKSSRRL 62

Query: 53  LTAASPGRAGASGRNTHIRKSRSAQLKLELDEVSSGAALSRASSASLGLSFSFTGFTMPP 112
           +   SPGR+  SG  THIRKSRSAQLKLEL+EVSSGAALSRASSASLGLSFSFTGF MPP
Sbjct: 63  M-GMSPGRS--SGAGTHIRKSRSAQLKLELEEVSSGAALSRASSASLGLSFSFTGFAMPP 119

Query: 113 DEIADSKPFSDDD-IPEDIEAGTRERPKFQTEPTLPIYLKFTDVTYKVILKGMTSSEEKD 171
           +EI+DSKPFSDD+ IPEDIEAG +++PKFQ EPTLPI+LKF DVTYKV++K +TSS EK+
Sbjct: 120 EEISDSKPFSDDEMIPEDIEAG-KKKPKFQAEPTLPIFLKFRDVTYKVVIKKLTSSVEKE 178

Query: 172 ILNGITGSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKI 231
           IL GI+GSVNPGEVLALMGPSGSGKTTLL+LL+GR+ + + GGS+TYND PYSK LKSKI
Sbjct: 179 ILTGISGSVNPGEVLALMGPSGSGKTTLLSLLAGRISQSSTGGSVTYNDKPYSKYLKSKI 238

Query: 232 GFVTQDDVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGS 291
           GFVTQDDVLFPHLTVKETLTYAA LRLP TLT++QK++RA+DVI ELGLERCQDTMIGG+
Sbjct: 239 GFVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKKQRALDVIQELGLERCQDTMIGGA 298

Query: 292 FVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTT 351
           FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + ML DIAEAGKTV+TT
Sbjct: 299 FVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTILMLHDIAEAGKTVITT 358

Query: 352 IHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGN 411
           IHQPSSRLFH+FDKLILLG+GSLLYFGK+SEA+ YFSSIGCSP IAMNPAEFLLDLANGN
Sbjct: 359 IHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALDYFSSIGCSPLIAMNPAEFLLDLANGN 418

Query: 412 LHDVSVPSELQDRVQTENSENDTANGKPTPAIVHEYLVEAYETRVAENEKKKLMAPIPLD 471
           ++D+SVPSEL DRVQ  NS  +T  GKP+PA VHEYLVEAYETRVAE EKKKL+ P+PLD
Sbjct: 419 INDISVPSELDDRVQVGNSGRETQTGKPSPAAVHEYLVEAYETRVAEQEKKKLLDPVPLD 478

Query: 472 EEIKAKVSSPKRNWGASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQS 531
           EE KAK +  KR WG  W +QY ILF RG+KE RH+YFSWLR+TQVL+TAVILGLLWWQS
Sbjct: 479 EEAKAKSTRLKRQWGTCWWEQYCILFCRGLKERRHEYFSWLRVTQVLSTAVILGLLWWQS 538

Query: 532 DSKSPKGLEDQAGLLFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMYRLSAYFLART 591
           D ++P GL+DQAGLLFFIAVFW FFP+FTAIF FPQERAML+KERAADMYRLSAYFLART
Sbjct: 539 DIRTPMGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYRLSAYFLART 598

Query: 592 TSDLPLNLVLPVLFLVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQ 637
           TSDLPL+ +LP LFL++VYFM GLR+   PFFLSMLTVFL I+AAQ
Sbjct: 599 TSDLPLDFILPSLFLLVVYFMTGLRISPYPFFLSMLTVFLCIIAAQ 644





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 Back     alignment and function description
>sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=2 SV=2 Back     alignment and function description
>sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 Back     alignment and function description
>sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 Back     alignment and function description
>sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=2 SV=1 Back     alignment and function description
>sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=2 SV=2 Back     alignment and function description
>sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query650
224138238744 white-brown-complex ABC transporter fami 0.975 0.852 0.85 0.0
255566225749 ATP-binding cassette transporter, putati 0.976 0.847 0.834 0.0
356500545743 PREDICTED: ABC transporter G family memb 0.967 0.846 0.834 0.0
356534584738 PREDICTED: ABC transporter G family memb 0.963 0.848 0.826 0.0
356505453740 PREDICTED: ABC transporter G family memb 0.967 0.85 0.802 0.0
356570916736 PREDICTED: ABC transporter G family memb 0.956 0.845 0.810 0.0
224091479743 white-brown-complex ABC transporter fami 0.975 0.853 0.830 0.0
296089333738 unnamed protein product [Vitis vinifera] 0.961 0.846 0.828 0.0
297810759750 abc transporter family protein [Arabidop 0.975 0.845 0.770 0.0
449437512749 PREDICTED: ABC transporter G family memb 0.976 0.847 0.800 0.0
>gi|224138238|ref|XP_002322764.1| white-brown-complex ABC transporter family [Populus trichocarpa] gi|222867394|gb|EEF04525.1| white-brown-complex ABC transporter family [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1096 bits (2835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/640 (85%), Positives = 596/640 (93%), Gaps = 6/640 (0%)

Query: 1   MEKPVSSTSLARTKSDQLVETLSAAFKSPVSSETAGASDG--GGTLSRKSSRRMLTAASP 58
           MEK   +TSLART+S+QLVET++AAFKSP ++E  G SDG  GGTLSRKSS+R++ AASP
Sbjct: 1   MEK--ENTSLARTRSEQLVETVAAAFKSPSNNEAIGVSDGSSGGTLSRKSSKRLMMAASP 58

Query: 59  GRAGASG-RNTHIRKSRSAQLKLELDEVSSGAALSRASSASLGLSFSFTGFTMPPDEIAD 117
           GR+ + G +NTHIRKSRSAQ+K +LD+VSSGAALSRASSASLG SFSFTGF MPPDEIAD
Sbjct: 59  GRSTSGGNKNTHIRKSRSAQMKFDLDDVSSGAALSRASSASLGFSFSFTGFNMPPDEIAD 118

Query: 118 SKPFSDDDIPEDIEAGTRERPKFQTEPTLPIYLKFTDVTYKVILKGMTSSEEKDILNGIT 177
           SKPFSDDDIPED+EAGTR +PKFQTEPTLPIYLKFTDVTYKVI+KGMTS+EEKDIL GI+
Sbjct: 119 SKPFSDDDIPEDLEAGTR-KPKFQTEPTLPIYLKFTDVTYKVIIKGMTSTEEKDILYGIS 177

Query: 178 GSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQD 237
           GSV+PGEVLALMGPSGSGKTTLLNL+ GRL + TVGGS+TYND PYSK LKS+IGFVTQD
Sbjct: 178 GSVDPGEVLALMGPSGSGKTTLLNLIGGRLNQTTVGGSLTYNDQPYSKFLKSRIGFVTQD 237

Query: 238 DVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVS 297
           DVLFPHLTVKETLTYAALLRLP TLTK+QK+KRAIDVI ELGLERCQDTMIGGSFVRGVS
Sbjct: 238 DVLFPHLTVKETLTYAALLRLPKTLTKEQKQKRAIDVIYELGLERCQDTMIGGSFVRGVS 297

Query: 298 GGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPSS 357
           GGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQ+LQDIAE GKTVVTTIHQPSS
Sbjct: 298 GGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQLLQDIAEGGKTVVTTIHQPSS 357

Query: 358 RLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGNLHDVSV 417
           RLFHKFDKLILLGKGSLLYFGKASEAM YFSSIGC+P IAMNPAEFLLDLANGN++DVSV
Sbjct: 358 RLFHKFDKLILLGKGSLLYFGKASEAMLYFSSIGCNPLIAMNPAEFLLDLANGNINDVSV 417

Query: 418 PSELQDRVQTENSENDTANGKPTPAIVHEYLVEAYETRVAENEKKKLMAPIPLDEEIKAK 477
           PSEL+D+VQ  NSE +T NGKP+PA+VHEYLVEAYETRVA+ EKKKLM PIPLDEE+K+K
Sbjct: 418 PSELEDKVQIGNSEAETRNGKPSPAVVHEYLVEAYETRVADKEKKKLMVPIPLDEEVKSK 477

Query: 478 VSSPKRNWGASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQSDSKSPK 537
           VSS KR WGASW +QYTILF RGIKE RHDYFSWLRITQVL+TA+ILGLLWW+SDS SPK
Sbjct: 478 VSSRKRQWGASWWEQYTILFCRGIKERRHDYFSWLRITQVLSTAIILGLLWWKSDSSSPK 537

Query: 538 GLEDQAGLLFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPL 597
           GL+DQAGLLFFIAVFW FFP+FTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPL
Sbjct: 538 GLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPL 597

Query: 598 NLVLPVLFLVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQ 637
           +L+LPVLFL++VYFMAGLR+ A PFFL+MLTVFL IVAAQ
Sbjct: 598 DLILPVLFLLVVYFMAGLRLSAAPFFLTMLTVFLCIVAAQ 637




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255566225|ref|XP_002524100.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223536668|gb|EEF38310.1| ATP-binding cassette transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356500545|ref|XP_003519092.1| PREDICTED: ABC transporter G family member 22-like [Glycine max] Back     alignment and taxonomy information
>gi|356534584|ref|XP_003535833.1| PREDICTED: ABC transporter G family member 22-like [Glycine max] Back     alignment and taxonomy information
>gi|356505453|ref|XP_003521505.1| PREDICTED: ABC transporter G family member 22-like [Glycine max] Back     alignment and taxonomy information
>gi|356570916|ref|XP_003553629.1| PREDICTED: ABC transporter G family member 22-like [Glycine max] Back     alignment and taxonomy information
>gi|224091479|ref|XP_002309268.1| white-brown-complex ABC transporter family [Populus trichocarpa] gi|222855244|gb|EEE92791.1| white-brown-complex ABC transporter family [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296089333|emb|CBI39105.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297810759|ref|XP_002873263.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata] gi|297319100|gb|EFH49522.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449437512|ref|XP_004136536.1| PREDICTED: ABC transporter G family member 22-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query650
TAIR|locus:2144133751 ABCG22 "ATP-binding cassette G 0.973 0.842 0.698 2.4e-234
TAIR|locus:2090009 685 ABCG26 "ATP-binding cassette G 0.703 0.667 0.482 3.6e-120
TAIR|locus:2016089662 ABCG25 "ATP-binding casette G2 0.376 0.370 0.585 8.2e-110
TAIR|locus:2028656 648 ABCG14 "ATP-binding cassette G 0.564 0.566 0.498 1e-91
MGI|MGI:1347061 657 Abcg2 "ATP-binding cassette, s 0.743 0.735 0.342 7.2e-68
UNIPROTKB|B2D1N9 658 ABCG2 "ATP-binding cassette su 0.729 0.720 0.345 1.2e-67
UNIPROTKB|Q4GZT4 655 ABCG2 "ATP-binding cassette su 0.729 0.723 0.345 1.2e-67
RGD|631345 657 Abcg2 "ATP-binding cassette, s 0.723 0.715 0.327 1.1e-66
ZFIN|ZDB-GENE-050517-37 634 abcg2c "ATP-binding cassette, 0.756 0.776 0.333 1.1e-66
UNIPROTKB|Q9UNQ0 655 ABCG2 "ATP-binding cassette su 0.730 0.725 0.344 2.2e-66
TAIR|locus:2144133 ABCG22 "ATP-binding cassette G22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2246 (795.7 bits), Expect = 2.4e-234, Sum P(2) = 2.4e-234
 Identities = 451/646 (69%), Positives = 511/646 (79%)

Query:     1 MEKPVSSTSLARTKSDQLVETLSAAFKSPVSS-------ETAGAS-DGGGTLSRKSSRRM 52
             MEKP  ++ LART+S+QL ET++A  +SP  S        TA A+  GGGTLSRKSSRR+
Sbjct:     3 MEKPPLASGLARTRSEQLYETVAADIRSPHGSMDANGVPATAPAAVGGGGTLSRKSSRRL 62

Query:    53 LTXXXXXXXXXXXXNTHIRKSRSAQLKLELDEVXXXXXXXXXXXXXXXXXXXXXXXTMPP 112
             +              THIRKSRSAQLKLEL+EV                        MPP
Sbjct:    63 M---GMSPGRSSGAGTHIRKSRSAQLKLELEEVSSGAALSRASSASLGLSFSFTGFAMPP 119

Query:   113 DEIADSKPFSDDD-IPEDIEAGTRERPKFQTEPTLPIYLKFTDVTYKVILKGMTSSEEKD 171
             +EI+DSKPFSDD+ IPEDIEAG +++PKFQ EPTLPI+LKF DVTYKV++K +TSS EK+
Sbjct:   120 EEISDSKPFSDDEMIPEDIEAG-KKKPKFQAEPTLPIFLKFRDVTYKVVIKKLTSSVEKE 178

Query:   172 ILNGITGSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKI 231
             IL GI+GSVNPGEVLALMGPSGSGKTTLL+LL+GR+ + + GGS+TYND PYSK LKSKI
Sbjct:   179 ILTGISGSVNPGEVLALMGPSGSGKTTLLSLLAGRISQSSTGGSVTYNDKPYSKYLKSKI 238

Query:   232 GFVTQDDVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGS 291
             GFVTQDDVLFPHLTVKETLTYAA LRLP TLT++QK++RA+DVI ELGLERCQDTMIGG+
Sbjct:   239 GFVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKKQRALDVIQELGLERCQDTMIGGA 298

Query:   292 FVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTT 351
             FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + ML DIAEAGKTV+TT
Sbjct:   299 FVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTILMLHDIAEAGKTVITT 358

Query:   352 IHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGN 411
             IHQPSSRLFH+FDKLILLG+GSLLYFGK+SEA+ YFSSIGCSP IAMNPAEFLLDLANGN
Sbjct:   359 IHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALDYFSSIGCSPLIAMNPAEFLLDLANGN 418

Query:   412 LHDVSVPSELQDRVQTENSENDTANGKPTPAIVHEYLVEAYETRVAENEKKKLMAPIPLD 471
             ++D+SVPSEL DRVQ  NS  +T  GKP+PA VHEYLVEAYETRVAE EKKKL+ P+PLD
Sbjct:   419 INDISVPSELDDRVQVGNSGRETQTGKPSPAAVHEYLVEAYETRVAEQEKKKLLDPVPLD 478

Query:   472 EEIKAKVSSPKRNWGASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQS 531
             EE KAK +  KR WG  W +QY ILF RG+KE RH+YFSWLR+TQVL+TAVILGLLWWQS
Sbjct:   479 EEAKAKSTRLKRQWGTCWWEQYCILFCRGLKERRHEYFSWLRVTQVLSTAVILGLLWWQS 538

Query:   532 DSKSPKGLEDQAGLLFFIAVFWSXXXXXXXXXXXXQERAMLSKERAADMYRLSAYFLART 591
             D ++P GL+DQAGLLFFIAVFW             QERAML+KERAADMYRLSAYFLART
Sbjct:   539 DIRTPMGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYRLSAYFLART 598

Query:   592 TSDXXXXXXXXXXXXXXXYFMAGLRMGAGPFFLSMLTVFLSIVAAQ 637
             TSD               YFM GLR+   PFFLSMLTVFL I+AAQ
Sbjct:   599 TSDLPLDFILPSLFLLVVYFMTGLRISPYPFFLSMLTVFLCIIAAQ 644


GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0016020 "membrane" evidence=IEA
GO:0016887 "ATPase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=ISS
GO:0005886 "plasma membrane" evidence=IDA
GO:0009414 "response to water deprivation" evidence=IMP
GO:0010148 "transpiration" evidence=IMP
TAIR|locus:2090009 ABCG26 "ATP-binding cassette G26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016089 ABCG25 "ATP-binding casette G25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028656 ABCG14 "ATP-binding cassette G14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1347061 Abcg2 "ATP-binding cassette, sub-family G (WHITE), member 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|B2D1N9 ABCG2 "ATP-binding cassette sub-family G member 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q4GZT4 ABCG2 "ATP-binding cassette sub-family G member 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|631345 Abcg2 "ATP-binding cassette, subfamily G (WHITE), member 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050517-37 abcg2c "ATP-binding cassette, sub-family G (WHITE), member 2c" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UNQ0 ABCG2 "ATP-binding cassette sub-family G member 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q93YS4AB22G_ARATHNo assigned EC number0.77080.97380.8428yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pg.C_LG_XVI0528
white-brown-complex ABC transporter family (744 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query650
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisio 1e-178
TIGR00955 617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 1e-124
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 2e-82
cd03234226 cd03234, ABCG_White, White pigment protein homolog 4e-76
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 5e-70
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 1e-69
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 7e-62
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 1e-60
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family membe 6e-57
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 7e-51
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 3e-41
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 2e-40
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 8e-39
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family membe 2e-37
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 5e-37
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 1e-36
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 1e-36
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 3e-36
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 3e-35
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 5e-35
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 8e-35
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 2e-34
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 1e-33
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 2e-33
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 2e-33
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 3e-33
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 8e-32
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 8e-32
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 4e-31
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 5e-31
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 6e-31
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 8e-31
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 8e-31
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 2e-30
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 4e-30
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 4e-30
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 4e-30
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 6e-30
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 7e-30
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 2e-29
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 3e-29
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 3e-29
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 3e-29
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 3e-29
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 4e-29
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 4e-29
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 5e-29
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 7e-29
COG4988559 COG4988, CydD, ABC-type transport system involved 8e-29
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 1e-28
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 4e-28
pfam01061210 pfam01061, ABC2_membrane, ABC-2 type transporter 5e-28
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 8e-28
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 1e-27
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 1e-27
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 2e-27
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 4e-27
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 4e-27
COG1123539 COG1123, COG1123, ATPase components of various ABC 6e-27
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 9e-27
COG4525259 COG4525, TauB, ABC-type taurine transport system, 9e-27
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 1e-26
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 1e-26
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 1e-26
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 2e-26
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 2e-26
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 3e-26
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 3e-26
COG1123539 COG1123, COG1123, ATPase components of various ABC 4e-26
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 5e-26
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 1e-25
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 1e-25
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 6e-25
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 6e-25
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 7e-25
COG4987573 COG4987, CydC, ABC-type transport system involved 9e-25
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 2e-24
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 2e-24
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 2e-24
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 2e-24
pfam00005119 pfam00005, ABC_tran, ABC transporter 3e-24
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 4e-24
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 5e-24
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 5e-24
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 8e-24
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 9e-24
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 1e-23
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 2e-23
COG4148352 COG4148, ModC, ABC-type molybdate transport system 2e-23
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 2e-23
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 2e-23
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 2e-23
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 2e-23
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 2e-23
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 3e-23
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 4e-23
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 4e-23
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 5e-23
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 5e-23
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 6e-23
PRK11124242 PRK11124, artP, arginine transporter ATP-binding s 6e-23
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 6e-23
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 7e-23
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 9e-23
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 1e-22
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 1e-22
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/orni 1e-22
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 1e-22
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 1e-22
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 1e-22
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 2e-22
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 2e-22
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 3e-22
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 4e-22
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 5e-22
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transpo 6e-22
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 6e-22
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 8e-22
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 8e-22
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 1e-21
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 2e-21
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 3e-21
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 3e-21
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 3e-21
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 3e-21
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 4e-21
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 5e-21
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 5e-21
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 6e-21
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 7e-21
COG4598256 COG4598, HisP, ABC-type histidine transport system 8e-21
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 8e-21
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 1e-20
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine tr 1e-20
COG1117253 COG1117, PstB, ABC-type phosphate transport system 1e-20
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 2e-20
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 2e-20
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 2e-20
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 2e-20
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 4e-20
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 4e-20
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 4e-20
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 4e-20
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 6e-20
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 7e-20
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transpor 7e-20
PRK11144352 PRK11144, modC, molybdate transporter ATP-binding 1e-19
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 2e-19
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-bind 2e-19
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 3e-19
COG5265497 COG5265, ATM1, ABC-type transport system involved 6e-19
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 8e-19
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 9e-19
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 1e-18
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 2e-18
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporte 2e-18
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 2e-18
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-18
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 3e-18
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 4e-18
PRK11000369 PRK11000, PRK11000, maltose/maltodextrin transport 5e-18
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transpo 6e-18
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 7e-18
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 8e-18
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 1e-17
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 2e-17
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 4e-17
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate es 4e-17
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 4e-17
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 4e-17
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 5e-17
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 5e-17
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding pro 5e-17
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 5e-17
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 7e-17
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 8e-17
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; 1e-16
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 1e-16
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 1e-16
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 1e-16
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase 2e-16
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 2e-16
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 2e-16
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 2e-16
COG0488530 COG0488, Uup, ATPase components of ABC transporter 2e-16
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 3e-16
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 3e-16
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 3e-16
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 4e-16
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 4e-16
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 5e-16
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding sub 6e-16
PRK10070400 PRK10070, PRK10070, glycine betaine transporter AT 6e-16
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/ 7e-16
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 9e-16
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 9e-16
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 1e-15
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 2e-15
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding sub 2e-15
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 2e-15
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 2e-15
COG0488530 COG0488, Uup, ATPase components of ABC transporter 3e-15
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 3e-15
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding 4e-15
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 4e-15
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 5e-15
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 5e-15
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system prote 5e-15
PRK11650356 PRK11650, ugpC, glycerol-3-phosphate transporter A 5e-15
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 5e-15
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-bind 6e-15
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protei 6e-15
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Pr 6e-15
COG4133209 COG4133, CcmA, ABC-type transport system involved 6e-15
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 7e-15
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 8e-15
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding sub 8e-15
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide tran 8e-15
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding prote 9e-15
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 2e-14
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; 2e-14
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 2e-14
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 2e-14
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 2e-14
PRK10789569 PRK10789, PRK10789, putative multidrug transporter 3e-14
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 3e-14
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding sub 3e-14
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter 3e-14
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 5e-14
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 7e-14
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 7e-14
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 9e-14
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP- 9e-14
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding 9e-14
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 1e-13
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 1e-13
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 1e-13
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 1e-13
PRK09580248 PRK09580, sufC, cysteine desulfurase ATPase compon 1e-13
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-bind 1e-13
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding 1e-13
COG4778235 COG4778, PhnL, ABC-type phosphonate transport syst 2e-13
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 2e-13
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 2e-13
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP- 2e-13
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding sub 2e-13
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP- 3e-13
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system 3e-13
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 3e-13
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 3e-13
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 5e-13
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transpor 6e-13
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 7e-13
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-bi 7e-13
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 1e-12
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 1e-12
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP- 1e-12
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 1e-12
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP 2e-12
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding sub 2e-12
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit 3e-12
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding sub 3e-12
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 3e-12
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding sub 3e-12
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter 3e-12
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 3e-12
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP- 3e-12
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 4e-12
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 5e-12
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 5e-12
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC syst 6e-12
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP- 8e-12
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-bind 8e-12
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-bind 9e-12
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP- 1e-11
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding sub 1e-11
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP- 1e-11
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 1e-11
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 2e-11
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 2e-11
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 3e-11
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 3e-11
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 1e-10
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 1e-10
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-b 1e-10
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 2e-10
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 2e-10
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 2e-10
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 2e-10
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 2e-10
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP 3e-10
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP- 3e-10
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP- 3e-10
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 4e-10
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP- 4e-10
PRK09473330 PRK09473, oppD, oligopeptide transporter ATP-bindi 5e-10
cd03369207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 6e-10
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provision 7e-10
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding 7e-10
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP- 8e-10
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP- 9e-10
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 1e-09
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 1e-09
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protei 1e-09
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding sub 2e-09
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 2e-09
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter 3e-09
TIGR03415382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter 3e-09
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-bin 3e-09
PRK10938490 PRK10938, PRK10938, putative molybdenum transport 5e-09
PRK11022326 PRK11022, dppD, dipeptide transporter ATP-binding 8e-09
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 9e-09
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predi 1e-08
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-bind 1e-08
cd03291282 cd03291, ABCC_CFTR1, ATP-binding cassette domain o 1e-08
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provision 2e-08
PRK10636638 PRK10636, PRK10636, putative ABC transporter ATP-b 2e-08
COG4170330 COG4170, SapD, ABC-type antimicrobial peptide tran 2e-08
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP bindi 2e-08
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 9e-08
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 1e-07
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding pr 1e-07
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-b 1e-07
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-bi 2e-07
PRK10636 638 PRK10636, PRK10636, putative ABC transporter ATP-b 2e-07
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding 2e-07
PRK10790592 PRK10790, PRK10790, putative multidrug transporter 2e-07
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protei 2e-07
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding sub 2e-07
cd03288257 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 3e-07
cd03290218 cd03290, ABCC_SUR1_N, ATP-binding cassette domain 4e-07
PRK15079331 PRK15079, PRK15079, oligopeptide ABC transporter A 5e-07
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family membe 6e-07
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 1e-06
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP bindi 1e-06
cd03289275 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 2e-06
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside t 2e-06
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 2e-06
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 3e-06
PRK13546264 PRK13546, PRK13546, teichoic acids export protein 4e-06
PRK13545549 PRK13545, tagH, teichoic acids export protein ATP- 5e-06
PTZ002431560 PTZ00243, PTZ00243, ABC transporter; Provisional 7e-06
cd03238176 cd03238, ABC_UvrA, ATP-binding cassette domain of 7e-06
smart00382148 smart00382, AAA, ATPases associated with a variety 8e-06
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 9e-06
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 9e-06
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP- 1e-05
PRK10418254 PRK10418, nikD, nickel transporter ATP-binding pro 3e-05
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding 4e-05
COG4615546 COG4615, PvdE, ABC-type siderophore export system, 7e-05
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 1e-04
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transpo 2e-04
cd03227162 cd03227, ABC_Class2, ATP-binding cassette domain o 2e-04
PRK15093330 PRK15093, PRK15093, antimicrobial peptide ABC tran 2e-04
PRK11147635 PRK11147, PRK11147, ABC transporter ATPase compone 3e-04
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 6e-04
pfam03193161 pfam03193, DUF258, Protein of unknown function, DU 0.001
cd01854211 cd01854, YjeQ_EngC, Ribosomal interacting GTPase Y 0.001
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 0.002
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-b 0.002
cd03271261 cd03271, ABC_UvrA_II, ATP-binding cassette domain 0.002
pfam13304256 pfam13304, AAA_21, AAA domain 0.002
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Prov 0.003
PRK01889356 PRK01889, PRK01889, GTPase RsgA; Reviewed 0.004
cd03222177 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassett 0.004
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
 Score =  520 bits (1340), Expect = e-178
 Identities = 248/561 (44%), Positives = 348/561 (62%), Gaps = 59/561 (10%)

Query: 105 FTGFTMPPDEIADSKPFSDDDIPEDIEAGTRERPKFQTEPTLPIYLKFTDVTYKVILKGM 164
           F G     D    SKP S D         +R+ P        PI LKF DV Y+V  + M
Sbjct: 4   FDGVENQNDGPDRSKPPSQD---------SRDLPSLLLSSCYPITLKFMDVCYRVKFENM 54

Query: 165 TSS---------------------EEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLL 203
            +                      +E+ ILNG+TG  +PGE+LA++GPSGSGK+TLLN L
Sbjct: 55  KNKGSNIKRILGHKPKISDETRQIQERTILNGVTGMASPGEILAVLGPSGSGKSTLLNAL 114

Query: 204 SGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPNTLT 263
           +GR+      G+I  N+   +K +  + GFVTQDD+L+PHLTV+ETL + +LLRLP +LT
Sbjct: 115 AGRIQGNNFTGTILANNRKPTKQILKRTGFVTQDDILYPHLTVRETLVFCSLLRLPKSLT 174

Query: 264 KQQKEKRAIDVINELGLERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPT 323
           KQ+K   A  VI+ELGL +C++T+IG SF+RG+SGGERKRV I +E++INPSLL LDEPT
Sbjct: 175 KQEKILVAESVISELGLTKCENTIIGNSFIRGISGGERKRVSIAHEMLINPSLLILDEPT 234

Query: 324 SGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEA 383
           SGLD+T A R+V  L  +A+ GKT+VT++HQPSSR++  FD +++L +G  L+FGK S+A
Sbjct: 235 SGLDATAAYRLVLTLGSLAQKGKTIVTSMHQPSSRVYQMFDSVLVLSEGRCLFFGKGSDA 294

Query: 384 MAYFSSIGCSPQIAMNPAEFLLDLANGNLHDVSVPSELQDRVQTENSENDTANGKPTPAI 443
           MAYF S+G SP   MNPA+FLLDLANG      V            SE +  N       
Sbjct: 295 MAYFESVGFSPSFPMNPADFLLDLANGVCQTDGV------------SEREKPN------- 335

Query: 444 VHEYLVEAYETRVAENEKKKL-MAPIPLDEEIKAKVSSPKRNWG------ASWIQQYTIL 496
           V + LV +Y T +A   K  + M+  P         +S K +        ++W  Q++IL
Sbjct: 336 VKQSLVASYNTLLAPKVKAAIEMSHFPQANARFVGSASTKEHRSSDRISISTWFNQFSIL 395

Query: 497 FRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQSDSKSPKGLEDQAGLLFFIAVFWSFF 556
            +R +KE +H+ F+ LR+ QV+A A++ GL+WW SD +    ++D+ GLLFFI++FW  F
Sbjct: 396 LQRSLKERKHESFNTLRVFQVIAAALLAGLMWWHSDFRD---VQDRLGLLFFISIFWGVF 452

Query: 557 PIFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPLNLVLPVLFLVIVYFMAGLR 616
           P F ++F FPQERA+  KERA+ MY LS+YF+AR   DLP+ L+LP +FL + Y+MAGL+
Sbjct: 453 PSFNSVFVFPQERAIFVKERASGMYTLSSYFMARIVGDLPMELILPTIFLTVTYWMAGLK 512

Query: 617 MGAGPFFLSMLTVFLSIVAAQ 637
              G F L++L +   ++ +Q
Sbjct: 513 PELGAFLLTLLVLLGYVLVSQ 533


Length = 659

>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|216273 pfam01061, ABC2_membrane, ABC-2 type transporter Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181888 PRK09473, oppD, oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213203 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-binding cassette domain 1 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>gnl|CDD|182906 PRK11022, dppD, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|225265 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226639 COG4170, SapD, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR Back     alignment and domain information
>gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C Back     alignment and domain information
>gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|184131 PRK13546, PRK13546, teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184130 PRK13545, tagH, teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|213205 cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236688 PRK10418, nikD, nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter Back     alignment and domain information
>gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins Back     alignment and domain information
>gnl|CDD|185049 PRK15093, PRK15093, antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|217416 pfam03193, DUF258, Protein of unknown function, DUF258 Back     alignment and domain information
>gnl|CDD|206747 cd01854, YjeQ_EngC, Ribosomal interacting GTPase YjeQ/EngC, a circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|213238 cd03271, ABC_UvrA_II, ATP-binding cassette domain II of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|222036 pfam13304, AAA_21, AAA domain Back     alignment and domain information
>gnl|CDD|215558 PLN03073, PLN03073, ABC transporter F family; Provisional Back     alignment and domain information
>gnl|CDD|234988 PRK01889, PRK01889, GTPase RsgA; Reviewed Back     alignment and domain information
>gnl|CDD|213189 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassette domain of RNase L inhibitor Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 650
PLN03211 659 ABC transporter G-25; Provisional 100.0
KOG0061 613 consensus Transporter, ABC superfamily (Breast can 100.0
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 100.0
PLN03140 1470 ABC transporter G family member; Provisional 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 100.0
PLN03140 1470 ABC transporter G family member; Provisional 100.0
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 100.0
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
PRK11607377 potG putrescine transporter ATP-binding subunit; P 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10789569 putative multidrug transporter membrane\ATP-bindin 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
COG4618580 ArpD ABC-type protease/lipase transport system, AT 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG0411250 LivG ABC-type branched-chain amino acid transport 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
COG4152300 ABC-type uncharacterized transport system, ATPase 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 100.0
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 100.0
PLN031301622 ABC transporter C family member; Provisional 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4175386 ProV ABC-type proline/glycine betaine transport sy 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 100.0
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 100.0
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
PTZ002431560 ABC transporter; Provisional 100.0
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4559259 ABC-type hemin transport system, ATPase component 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 100.0
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 100.0
PRK09580248 sufC cysteine desulfurase ATPase component; Review 100.0
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 100.0
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
COG4598256 HisP ABC-type histidine transport system, ATPase c 100.0
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 100.0
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 100.0
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 100.0
COG4525259 TauB ABC-type taurine transport system, ATPase com 100.0
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK03695248 vitamin B12-transporter ATPase; Provisional 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 100.0
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 100.0
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 100.0
COG4181228 Predicted ABC-type transport system involved in ly 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 100.0
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 100.0
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 100.0
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 100.0
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 100.0
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 100.0
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 100.0
COG1129500 MglA ABC-type sugar transport system, ATPase compo 100.0
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 100.0
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 100.0
PRK13546264 teichoic acids export protein ATP-binding subunit; 100.0
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 100.0
cd03246173 ABCC_Protease_Secretion This family represents the 100.0
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 100.0
COG4172534 ABC-type uncharacterized transport system, duplica 100.0
COG4161242 ArtP ABC-type arginine transport system, ATPase co 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 100.0
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 100.0
cd03215182 ABC_Carb_Monos_II This family represents domain II 100.0
PRK10938490 putative molybdenum transport ATP-binding protein 100.0
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 100.0
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 100.0
PRK13545549 tagH teichoic acids export protein ATP-binding sub 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 100.0
PRK10522547 multidrug transporter membrane component/ATP-bindi 100.0
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
PLN03232 1495 ABC transporter C family member; Provisional 100.0
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 100.0
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 100.0
COG4148352 ModC ABC-type molybdate transport system, ATPase c 100.0
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 100.0
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
COG4619223 ABC-type uncharacterized transport system, ATPase 100.0
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 100.0
cd03216163 ABC_Carb_Monos_I This family represents the domain 100.0
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 100.0
COG3845501 ABC-type uncharacterized transport systems, ATPase 100.0
PLN03130 1622 ABC transporter C family member; Provisional 100.0
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 100.0
PRK10535 648 macrolide transporter ATP-binding /permease protei 100.0
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 100.0
PRK15064530 ABC transporter ATP-binding protein; Provisional 100.0
PRK11819556 putative ABC transporter ATP-binding protein; Revi 100.0
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 100.0
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
COG1119257 ModF ABC-type molybdenum transport system, ATPase 100.0
PRK10938490 putative molybdenum transport ATP-binding protein 100.0
PRK15064530 ABC transporter ATP-binding protein; Provisional 100.0
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 100.0
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 100.0
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 100.0
COG4172534 ABC-type uncharacterized transport system, duplica 100.0
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 100.0
KOG00541381 consensus Multidrug resistance-associated protein/ 100.0
PRK11819556 putative ABC transporter ATP-binding protein; Revi 100.0
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 100.0
COG4586325 ABC-type uncharacterized transport system, ATPase 100.0
COG4674249 Uncharacterized ABC-type transport system, ATPase 100.0
PRK13409590 putative ATPase RIL; Provisional 100.0
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 100.0
PRK10636638 putative ABC transporter ATP-binding protein; Prov 100.0
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 100.0
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 100.0
PRK11147635 ABC transporter ATPase component; Reviewed 100.0
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 100.0
COG1101263 PhnK ABC-type uncharacterized transport system, AT 100.0
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 100.0
PLN03073718 ABC transporter F family; Provisional 100.0
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 100.0
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 100.0
COG4136213 ABC-type uncharacterized transport system, ATPase 100.0
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
KOG0059885 consensus Lipid exporter ABCA1 and related protein 100.0
PRK11147 635 ABC transporter ATPase component; Reviewed 100.0
COG4167267 SapF ABC-type antimicrobial peptide transport syst 100.0
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 100.0
KOG0054 1381 consensus Multidrug resistance-associated protein/ 100.0
PRK13409590 putative ATPase RIL; Provisional 100.0
PTZ00243 1560 ABC transporter; Provisional 100.0
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 100.0
COG0488530 Uup ATPase components of ABC transporters with dup 100.0
PLN03073718 ABC transporter F family; Provisional 99.98
COG4133209 CcmA ABC-type transport system involved in cytochr 99.98
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.97
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.97
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.97
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.97
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.96
COG0488530 Uup ATPase components of ABC transporters with dup 99.96
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.96
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.96
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.94
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.94
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.94
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.94
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.94
COG4615546 PvdE ABC-type siderophore export system, fused ATP 99.93
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.93
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.93
COG4178604 ABC-type uncharacterized transport system, permeas 99.93
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.93
COG4170330 SapD ABC-type antimicrobial peptide transport syst 99.92
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.91
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.91
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.91
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.89
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.88
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 99.88
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.88
KOG0062582 consensus ATPase component of ABC transporters wit 99.86
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.86
KOG2355291 consensus Predicted ABC-type transport, ATPase com 99.86
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 99.84
KOG0062582 consensus ATPase component of ABC transporters wit 99.84
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 99.83
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.82
cd03239178 ABC_SMC_head The structural maintenance of chromos 99.82
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 99.8
PRK006351809 excinuclease ABC subunit A; Provisional 99.78
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 99.78
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 99.78
KOG0064728 consensus Peroxisomal long-chain acyl-CoA transpor 99.78
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 99.78
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 99.77
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 99.76
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.75
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.72
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPa 99.71
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.7
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 99.7
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 99.65
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 99.64
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 99.58
KOG0063592 consensus RNAse L inhibitor, ABC superfamily [RNA 99.57
PRK00064361 recF recombination protein F; Reviewed 99.48
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 99.47
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 99.45
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 99.41
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 99.41
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 99.4
cd01128249 rho_factor Transcription termination factor rho is 99.39
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.35
KOG0063592 consensus RNAse L inhibitor, ABC superfamily [RNA 99.3
PRK07721438 fliI flagellum-specific ATP synthase; Validated 99.3
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 99.29
TIGR00634563 recN DNA repair protein RecN. All proteins in this 99.28
PHA02562562 46 endonuclease subunit; Provisional 99.25
PRK10869553 recombination and repair protein; Provisional 99.24
TIGR006181042 sbcc exonuclease SbcC. This family is based on the 99.24
PF01061210 ABC2_membrane: ABC-2 type transporter; InterPro: I 99.24
PRK00409782 recombination and DNA strand exchange inhibitor pr 99.22
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 99.19
PRK08533230 flagellar accessory protein FlaH; Reviewed 99.16
cd01124187 KaiC KaiC is a circadian clock protein primarily f 99.15
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 99.14
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 99.13
PRK13695174 putative NTPase; Provisional 99.09
PRK03918880 chromosome segregation protein; Provisional 99.08
TIGR006061311 rad50 rad50. This family is based on the phylogeno 99.05
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 99.04
PRK102461047 exonuclease subunit SbcC; Provisional 99.04
PRK13830818 conjugal transfer protein TrbE; Provisional 99.03
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 99.0
PRK06793432 fliI flagellum-specific ATP synthase; Validated 98.99
COG3910233 Predicted ATPase [General function prediction only 98.99
PRK01156895 chromosome segregation protein; Provisional 98.96
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 98.92
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 98.89
PRK06067234 flagellar accessory protein FlaH; Validated 98.88
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 98.79
PRK02224880 chromosome segregation protein; Provisional 98.78
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 98.78
TIGR03238504 dnd_assoc_3 dnd system-associated protein 3. cereu 98.76
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 98.75
smart00382148 AAA ATPases associated with a variety of cellular 98.72
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 98.57
PRK13891852 conjugal transfer protein TrbE; Provisional 98.57
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 98.53
TIGR01026440 fliI_yscN ATPase FliI/YscN family. This family of 98.51
PRK07196434 fliI flagellum-specific ATP synthase; Validated 98.51
TIGR00611365 recf recF protein. All proteins in this family for 98.5
PRK14079349 recF recombination protein F; Provisional 98.49
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 98.48
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 98.47
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 98.42
PRK06002450 fliI flagellum-specific ATP synthase; Validated 98.37
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 98.36
PRK05399854 DNA mismatch repair protein MutS; Provisional 98.32
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.29
PRK13898800 type IV secretion system ATPase VirB4; Provisional 98.28
TIGR026801353 conserved hypothetical protein TIGR02680. Members 98.27
PRK09825176 idnK D-gluconate kinase; Provisional 98.24
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 98.16
PRK13873811 conjugal transfer ATPase TrbE; Provisional 98.15
TIGR00767415 rho transcription termination factor Rho. Members 98.1
PRK06315442 type III secretion system ATPase; Provisional 98.09
PF09818448 ABC_ATPase: Predicted ATPase of the ABC class; Int 98.08
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.05
PRK01889356 GTPase RsgA; Reviewed 98.02
PF1355562 AAA_29: P-loop containing region of AAA domain 98.01
PRK00454196 engB GTP-binding protein YsxC; Reviewed 98.01
PRK09270229 nucleoside triphosphate hydrolase domain-containin 98.0
PRK03846198 adenylylsulfate kinase; Provisional 97.96
PF1355890 SbcCD_C: Putative exonuclease SbcCD, C subunit; PD 97.96
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 97.94
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 97.94
TIGR00235207 udk uridine kinase. Model contains a number of lon 97.93
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 97.93
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 97.93
TIGR00152188 dephospho-CoA kinase. This model produces scores i 97.91
PRK10416318 signal recognition particle-docking protein FtsY; 97.87
PRK08149428 ATP synthase SpaL; Validated 97.87
PRK13764602 ATPase; Provisional 97.84
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 97.83
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 97.82
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.81
PLN02318 656 phosphoribulokinase/uridine kinase 97.75
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
Probab=100.00  E-value=7e-87  Score=767.65  Aligned_cols=481  Identities=49%  Similarity=0.867  Sum_probs=399.3

Q ss_pred             CeeEEEEeEEEEEeeccc---------------------cccccccceeceEEEEeCCeEEEEECCCCCcHHHHHHHHHc
Q 006335          147 PIYLKFTDVTYKVILKGM---------------------TSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLSG  205 (650)
Q Consensus       147 ~~~l~~~nvs~~~~~~~~---------------------~~~~~~~iL~~vs~~i~~Ge~~aIvGpsGsGKSTLL~~L~G  205 (650)
                      +..++|.|++|+....+.                     ...+++++|+|||+++++||++||+||||||||||||+|+|
T Consensus        37 ~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~iL~~vs~~i~~Ge~~aI~GpnGaGKSTLL~iLaG  116 (659)
T PLN03211         37 PITLKFMDVCYRVKFENMKNKGSNIKRILGHKPKISDETRQIQERTILNGVTGMASPGEILAVLGPSGSGKSTLLNALAG  116 (659)
T ss_pred             ceEEEEEeEEEEEccCCCcccccccccccccccccccccccCCCCeeeeCCEEEEECCEEEEEECCCCCCHHHHHHHHhC
Confidence            567999999998753320                     01135679999999999999999999999999999999999


Q ss_pred             CCCCCCcceEEEECCEeCChhccCcEEEEccCCcCCCCCCHHHHHHHHHhccCCCCccHHHHHHHHHHHHHHcCCCcccc
Q 006335          206 RLMEPTVGGSITYNDHPYSKSLKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQD  285 (650)
Q Consensus       206 ~~~~~~~~G~I~~~G~~~~~~~~~~i~yV~Q~~~l~~~lTV~enl~~~~~~~~~~~~~~~~~~~~v~~~l~~lgL~~~~~  285 (650)
                      +......+|+|.+||+++....++++|||+|++.+++.+||+||+.|++.++.+...+++++.++++++++.+||.++.|
T Consensus       117 ~~~~~~~sG~I~inG~~~~~~~~~~i~yv~Q~~~l~~~lTV~E~l~~~a~~~~~~~~~~~~~~~~v~~~l~~lgL~~~~~  196 (659)
T PLN03211        117 RIQGNNFTGTILANNRKPTKQILKRTGFVTQDDILYPHLTVRETLVFCSLLRLPKSLTKQEKILVAESVISELGLTKCEN  196 (659)
T ss_pred             CCCCCceeEEEEECCEECchhhccceEEECcccccCCcCCHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHHHcCChhhcC
Confidence            76422248999999999876666789999999999999999999999887766555566677788999999999999999


Q ss_pred             ccccCccCCCCCHHHHHHHHHHHHHhhCCCEEEEeCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEecCCChHHHhhcCE
Q 006335          286 TMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDK  365 (650)
Q Consensus       286 t~vg~~~~~~LSGGerqRv~IA~aL~~~P~iLlLDEPTsgLD~~s~~~i~~~L~~l~~~g~TvI~~~H~~~~~i~~~~D~  365 (650)
                      |.+|+..+++|||||||||+||++|+.+|+||||||||+|||+.++..+++.|++++++|+|||+++||++.++++.||+
T Consensus       197 t~vg~~~~~~LSgGerqRv~ia~aL~~~P~iLlLDEPtsgLD~~~~~~l~~~L~~l~~~g~TvI~~sH~~~~~i~~~~D~  276 (659)
T PLN03211        197 TIIGNSFIRGISGGERKRVSIAHEMLINPSLLILDEPTSGLDATAAYRLVLTLGSLAQKGKTIVTSMHQPSSRVYQMFDS  276 (659)
T ss_pred             ceeCCCCCCCcChhhhhHHHHHHHHHhCCCEEEEeCCCCCcCHHHHHHHHHHHHHHHhCCCEEEEEecCCCHHHHHhhce
Confidence            99999889999999999999999999999999999999999999999999999999988999999999998778899999


Q ss_pred             EEEEeCCeEEEecCHHHHHHHHHhcCCCCCCCCChHHHHHHhhcCCCCCcCCCchhhhhhhcccccccccCCCCChhhHH
Q 006335          366 LILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGNLHDVSVPSELQDRVQTENSENDTANGKPTPAIVH  445 (650)
Q Consensus       366 iivL~~G~iv~~G~~~~~~~~f~~~g~~~~~~~npad~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  445 (650)
                      |++|++|++++.|+++++.+||+++|++||.+.|||||++|+++.+........          .+      .   ....
T Consensus       277 iilL~~G~iv~~G~~~~~~~~f~~~G~~~P~~~NpADf~ldv~~~~~~~~~~~~----------~~------~---~~~~  337 (659)
T PLN03211        277 VLVLSEGRCLFFGKGSDAMAYFESVGFSPSFPMNPADFLLDLANGVCQTDGVSE----------RE------K---PNVK  337 (659)
T ss_pred             EEEecCCcEEEECCHHHHHHHHHHCCCCCCCCCCHHHHHHHHcCccccCCCccc----------cc------c---chHH
Confidence            999999999999999999999999999999999999999999875421100000          00      0   0011


Q ss_pred             HHHHHHHHHHHHHHHHhhh--c-CCCCCcHHH---hhhc-CCCCCCCCCCHHHHHHHHHHHHHHHhhcchhHHHHHHHHH
Q 006335          446 EYLVEAYETRVAENEKKKL--M-APIPLDEEI---KAKV-SSPKRNWGASWIQQYTILFRRGIKEHRHDYFSWLRITQVL  518 (650)
Q Consensus       446 ~~l~~~~~~~~~~~~~~~~--~-~~~~~~~~~---~~~~-~~~~~~~~~s~~~Q~~~L~~R~~~~~r~~~~~~~r~~~~i  518 (650)
                      +.+.+.|++..........  . .........   .... ...++.+..+||+|+.+|++|+++++|++.+.++|+++++
T Consensus       338 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~Q~~~L~~R~~~~~r~~~~~~~r~~~~i  417 (659)
T PLN03211        338 QSLVASYNTLLAPKVKAAIEMSHFPQANARFVGSASTKEHRSSDRISISTWFNQFSILLQRSLKERKHESFNTLRVFQVI  417 (659)
T ss_pred             HHHHHHHHhhccHHHHHHHhhhhhhcchhhhhhcccccccccCCCccCCCHHHHHHHHHHHHHHHHhCcHHHHHHHHHHH
Confidence            1222333221110000000  0 000000000   0000 0112235678999999999999999999988889999999


Q ss_pred             HHHHHHHHHhcCCCCCChhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHhhCCCCChHHHHHHHHHHHHHHH
Q 006335          519 ATAVILGLLWWQSDSKSPKGLEDQAGLLFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPLN  598 (650)
Q Consensus       519 ~~aliiG~lf~~~~~~~~~~~~~~~g~lff~~~~~~~~~~~~~i~~~~~er~i~~rE~~~g~Y~~~ay~lAk~l~~lP~~  598 (650)
                      ++|+++|++||+++   +.++++|.|++||+++++++.+++.++..|++||++|+||+.+|+|++++|++|++++|+|+.
T Consensus       418 ~~~ll~G~lf~~~~---~~~~~~r~g~lff~~~~~~~~~~~~~~~~f~~er~v~~rE~~~~~Y~~~~Y~la~~l~elP~~  494 (659)
T PLN03211        418 AAALLAGLMWWHSD---FRDVQDRLGLLFFISIFWGVFPSFNSVFVFPQERAIFVKERASGMYTLSSYFMARIVGDLPME  494 (659)
T ss_pred             HHHHHHHHHHhcCC---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHhhhCCCCCHHHHHHHHHHHHHHHH
Confidence            99999999999984   578999999999999998988888999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhhhhhccCCCCChHHHHHHHHHHHHHHHHHHHHHHHHhhcccC
Q 006335          599 LVLPVLFLVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQVCPFITTDKINH  649 (650)
Q Consensus       599 ~~~~~~f~~i~Y~m~gl~~~~~~f~~f~l~~~l~~~~~~~lG~~~~~~~~~  649 (650)
                      ++.+++|++|+|||+||++++.+||+|++++++..++++++|++++++..+
T Consensus       495 ~~~~~if~~i~Y~m~Gl~~~~~~F~~f~li~~l~~~~~~s~g~~i~a~~~~  545 (659)
T PLN03211        495 LILPTIFLTVTYWMAGLKPELGAFLLTLLVLLGYVLVSQGLGLALGAAIMD  545 (659)
T ss_pred             HHHHHHHHhheeEcCCCcCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCC
Confidence            999999999999999999999999999999999999999999999988643



>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>PRK00064 recF recombination protein F; Reviewed Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>PF01061 ABC2_membrane: ABC-2 type transporter; InterPro: IPR013525 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>PRK13830 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK13891 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR00611 recf recF protein Back     alignment and domain information
>PRK14079 recF recombination protein F; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK05399 DNA mismatch repair protein MutS; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK13898 type IV secretion system ATPase VirB4; Provisional Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK13873 conjugal transfer ATPase TrbE; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK06315 type III secretion system ATPase; Provisional Back     alignment and domain information
>PF09818 ABC_ATPase: Predicted ATPase of the ABC class; InterPro: IPR019195 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query650
1l2t_A235 Dimeric Structure Of Mj0796, A Bacterial Abc Transp 9e-21
3tif_A235 Dimeric Structure Of A Post-Hydrolysis State Of The 1e-20
1f3o_A235 Crystal Structure Of Mj0796 Atp-Binding Cassette Le 1e-19
4ayw_A619 Structure Of The Human Mitochondrial Abc Transporte 6e-19
4ayt_A595 Structure Of The Human Mitochondrial Abc Transporte 7e-19
2yyz_A359 Crystal Structure Of Sugar Abc Transporter, Atp-Bin 1e-18
2ixf_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 2e-18
4f4c_A1321 The Crystal Structure Of The Multi-Drug Transporter 2e-18
2pcj_A224 Crystal Structure Of Abc Transporter (Aq_297) From 4e-18
3c41_J242 Abc Protein Artp In Complex With Amp-PnpMG2+ Length 5e-18
2it1_A362 Structure Of Ph0203 Protein From Pyrococcus Horikos 6e-18
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 7e-18
2olj_A263 Abc Protein Artp In Complex With AdpMG2+ Length = 2 7e-18
3g5u_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 1e-17
3g60_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 2e-17
3d31_A348 Modbc From Methanosarcina Acetivorans Length = 348 2e-17
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 2e-17
1mt0_A241 Atp-Binding Domain Of Haemolysin B From Escherichia 3e-17
2ff7_A247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 3e-17
1oxs_C353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 3e-17
2ixe_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 3e-17
1q12_A381 Crystal Structure Of The Atp-bound E. Coli Malk Len 3e-17
2pmk_A243 Crystal Structures Of An Isolated Abc-Atpase In Com 3e-17
1q1b_A381 Crystal Structure Of E. Coli Malk In The Nucleotide 3e-17
1vci_A373 Crystal Structure Of The Atp-binding Cassette Of Mu 5e-17
1v43_A372 Crystal Structure Of Atpase Subunit Of Abc Sugar Tr 5e-17
3b5j_A243 Crystal Structures Of The S504a Mutant Of An Isolat 6e-17
3qf4_A587 Crystal Structure Of A Heterodimeric Abc Transporte 7e-17
2ffb_A247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 7e-17
2r6g_A381 The Crystal Structure Of The E. Coli Maltose Transp 7e-17
1oxx_K353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 1e-16
1z47_A355 Structure Of The Atpase Subunit Cysa Of The Putativ 1e-16
1g29_1372 Malk Length = 372 2e-16
3fvq_A359 Crystal Structure Of The Nucleotide Binding Domain 3e-16
1xef_A241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 5e-16
2ffa_A247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 5e-16
2d62_A375 Crystal Structure Of Multiple Sugar Binding Transpo 6e-16
2ixg_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 8e-16
2yz2_A266 Crystal Structure Of The Abc Transporter In The Cob 1e-15
4hlu_A268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 2e-15
2ghi_A260 Crystal Structure Of Plasmodium Yoelii Multidrug Re 2e-15
3nh6_A306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 2e-15
3gfo_A275 Structure Of Cbio1 From Clostridium Perfringens: Pa 6e-15
3b5x_A582 Crystal Structure Of Msba From Vibrio Cholerae Leng 9e-15
1jj7_A260 Crystal Structure Of The C-Terminal Atpase Domain O 9e-15
3qf4_B598 Crystal Structure Of A Heterodimeric Abc Transporte 1e-14
1vpl_A256 Crystal Structure Of Abc Transporter Atp-binding Pr 4e-14
1b0u_A262 Atp-Binding Subunit Of The Histidine Permease From 4e-13
3dhw_C343 Crystal Structure Of Methionine Importer Metni Leng 6e-13
3b5y_A582 Crystal Structure Of Msba From Salmonella Typhimuri 7e-13
3tui_C366 Inward Facing Conformations Of The Metni Methionine 1e-12
3tuj_C366 Inward Facing Conformations Of The Metni Methionine 2e-12
3b5w_A582 Crystal Structure Of Eschericia Coli Msba Length = 4e-12
2onk_A240 Abc Transporter Modbc In Complex With Its Binding P 8e-12
2nq2_C253 An Inward-Facing Conformation Of A Putative Metal-C 2e-11
4dbl_C249 Crystal Structure Of E159q Mutant Of Btucdf Length 2e-11
4fi3_C249 Structure Of Vitamin B12 Transporter Btucd-F In A N 3e-11
2qi9_C249 Abc-Transporter Btucd In Complex With Its Periplasm 3e-11
2d3w_A248 Crystal Structure Of Escherichia Coli Sufc, An Atpa 4e-11
2zu0_C267 Crystal Structure Of Sufc-Sufd Complex Involved In 4e-11
1l7v_C249 Bacterial Abc Transporter Involved In B12 Uptake Le 4e-11
1ji0_A240 Crystal Structure Analysis Of The Abc Transporter F 6e-11
4hlu_D268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 2e-10
2pzg_A241 Minimal Human Cftr First Nucleotide Binding Domain 4e-10
2bbt_A290 Human Deltaf508 Nbd1 With Two Solublizing Mutations 1e-09
4g1u_C266 X-Ray Structure Of The Bacterial Heme Transporter H 1e-09
2bbs_A290 Human Deltaf508 Nbd1 With Three Solubilizing Mutati 1e-09
1g6h_A257 Crystal Structure Of The Adp Conformation Of Mj1267 1e-09
2pze_A229 Minimal Human Cftr First Nucleotide Binding Domain 2e-09
2pzf_A228 Minimal Human Cftr First Nucleotide Binding Domain 3e-09
1q3h_A286 Mouse Cftr Nbd1 With Amp.Pnp Length = 286 4e-09
1r0z_A286 Phosphorylated Cystic Fibrosis Transmembrane Conduc 4e-09
1sgw_A214 Putative Abc Transporter (Atp-Binding Protein) From 5e-09
1gaj_A257 Crystal Structure Of A Nucleotide-Free Atp-Binding 7e-09
3si7_A285 The Crystal Structure Of The Nbd1 Domain Of The Mou 9e-09
1yqt_A538 Rnase-L Inhibitor Length = 538 1e-08
1xmi_A291 Crystal Structure Of Human F508a Nbd1 Domain With A 1e-08
1xfa_A283 Structure Of Nbd1 From Murine Cftr- F508r Mutant Le 2e-08
1xf9_A283 Structure Of Nbd1 From Murine Cftr- F508s Mutant Le 2e-08
1g9x_A257 Characterization Of The Twinning Structure Of Mj126 2e-08
2d2e_A250 Crystal Structure Of Atypical Cytoplasmic Abc-Atpas 6e-08
2ihy_A279 Structure Of The Staphylococcus Aureus Putative Atp 6e-08
2bbo_A291 Human Nbd1 With Phe508 Length = 291 2e-07
1xmj_A290 Crystal Structure Of Human Deltaf508 Human Nbd1 Dom 5e-07
3bk7_A607 Structure Of The Complete Abce1RNAASE-L Inhibitor P 2e-06
3j16_B608 Models Of Ribosome-Bound Dom34p And Rli1p And Their 2e-06
3j15_B593 Model Of Ribosome-Bound Archaeal Pelota And Abce1 L 2e-06
4fwi_B334 Crystal Structure Of The Nucleotide-binding Domain 4e-06
2cbz_A237 Structure Of The Human Multidrug Resistance Protein 2e-05
3gd7_A390 Crystal Structure Of Human Nbd2 Complexed With N6- 1e-04
3pih_A916 T. Maritima Uvra In Complex With Fluorescein-Modifi 2e-04
3ozx_A538 Crystal Structure Of Abce1 Of Sulfolubus Solfataric 7e-04
>pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 Back     alignment and structure

Iteration: 1

Score = 98.6 bits (244), Expect = 9e-21, Method: Compositional matrix adjust. Identities = 67/210 (31%), Positives = 109/210 (51%), Gaps = 15/210 (7%) Query: 173 LNGITGSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYN-------DHPYSK 225 L + ++ GE +++MGPSGSGK+T+LN++ G L +PT G N D +K Sbjct: 21 LKNVNLNIKEGEFVSIMGPSGSGKSTMLNII-GCLDKPTEGEVYIDNIKTNDLDDDELTK 79 Query: 226 SLKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQD 285 + KIGFV Q L P LT E + + + ++ +++ KRA++ + LE Sbjct: 80 IRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEERRKRALECLKMAELEE--- 136 Query: 286 TMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEA- 344 +SGG+++RV I + NP ++ D+PT LDS T +I+Q+L+ + E Sbjct: 137 -RFANHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEED 195 Query: 345 GKTVVTTIHQPSSRLFHKFDKLILLGKGSL 374 GKTVV H + F +++I L G + Sbjct: 196 GKTVVVVTHDINVARFG--ERIIYLKDGEV 223
>pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 Back     alignment and structure
>pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 Back     alignment and structure
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 Back     alignment and structure
>pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 Back     alignment and structure
>pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 Back     alignment and structure
>pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 Back     alignment and structure
>pdb|1Q12|A Chain A, Crystal Structure Of The Atp-bound E. Coli Malk Length = 381 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|1Q1B|A Chain A, Crystal Structure Of E. Coli Malk In The Nucleotide-Free Form Length = 381 Back     alignment and structure
>pdb|1VCI|A Chain A, Crystal Structure Of The Atp-binding Cassette Of Multisugar Transporter From Pyrococcus Horikoshii Ot3 Complexed With Atp Length = 373 Back     alignment and structure
>pdb|1V43|A Chain A, Crystal Structure Of Atpase Subunit Of Abc Sugar Transporter Length = 372 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|2R6G|A Chain A, The Crystal Structure Of The E. Coli Maltose Transporter Length = 381 Back     alignment and structure
>pdb|1OXX|K Chain K, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|1G29|1 Chain 1, Malk Length = 372 Back     alignment and structure
>pdb|3FVQ|A Chain A, Crystal Structure Of The Nucleotide Binding Domain Fbpc Complexed With Atp Length = 359 Back     alignment and structure
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|2D62|A Chain A, Crystal Structure Of Multiple Sugar Binding Transport Atp- Binding Protein Length = 375 Back     alignment and structure
>pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 Back     alignment and structure
>pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 Back     alignment and structure
>pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 Back     alignment and structure
>pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 Back     alignment and structure
>pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 Back     alignment and structure
>pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permease From Salmonella Typhimurium Length = 262 Back     alignment and structure
>pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 Back     alignment and structure
>pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 Back     alignment and structure
>pdb|2NQ2|C Chain C, An Inward-Facing Conformation Of A Putative Metal-Chelate Type Abc Transporter. Length = 253 Back     alignment and structure
>pdb|4DBL|C Chain C, Crystal Structure Of E159q Mutant Of Btucdf Length = 249 Back     alignment and structure
>pdb|4FI3|C Chain C, Structure Of Vitamin B12 Transporter Btucd-F In A Nucleotide-Bound State Length = 249 Back     alignment and structure
>pdb|2QI9|C Chain C, Abc-Transporter Btucd In Complex With Its Periplasmic Binding Protein Btuf Length = 249 Back     alignment and structure
>pdb|2D3W|A Chain A, Crystal Structure Of Escherichia Coli Sufc, An Atpase Compenent Of The Suf Iron-Sulfur Cluster Assembly Machinery Length = 248 Back     alignment and structure
>pdb|2ZU0|C Chain C, Crystal Structure Of Sufc-Sufd Complex Involved In The Iron- Sulfur Cluster Biosynthesis Length = 267 Back     alignment and structure
>pdb|1L7V|C Chain C, Bacterial Abc Transporter Involved In B12 Uptake Length = 249 Back     alignment and structure
>pdb|1JI0|A Chain A, Crystal Structure Analysis Of The Abc Transporter From Thermotoga Maritima Length = 240 Back     alignment and structure
>pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|2PZG|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Monomer Length = 241 Back     alignment and structure
>pdb|2BBT|A Chain A, Human Deltaf508 Nbd1 With Two Solublizing Mutations. Length = 290 Back     alignment and structure
>pdb|4G1U|C Chain C, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv From Yersinia Pestis Length = 266 Back     alignment and structure
>pdb|2BBS|A Chain A, Human Deltaf508 Nbd1 With Three Solubilizing Mutations Length = 290 Back     alignment and structure
>pdb|1G6H|A Chain A, Crystal Structure Of The Adp Conformation Of Mj1267, An Atp- Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|2PZE|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer Length = 229 Back     alignment and structure
>pdb|2PZF|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer With Delta F508 Length = 228 Back     alignment and structure
>pdb|1Q3H|A Chain A, Mouse Cftr Nbd1 With Amp.Pnp Length = 286 Back     alignment and structure
>pdb|1R0Z|A Chain A, Phosphorylated Cystic Fibrosis Transmembrane Conductance Regulator (Cftr) Nucleotide-Binding Domain One (Nbd1) With Atp Length = 286 Back     alignment and structure
>pdb|1SGW|A Chain A, Putative Abc Transporter (Atp-Binding Protein) From Pyrococcus Furiosus Pfu-867808-001 Length = 214 Back     alignment and structure
>pdb|1GAJ|A Chain A, Crystal Structure Of A Nucleotide-Free Atp-Binding Cassette From An Abc Transporter Length = 257 Back     alignment and structure
>pdb|3SI7|A Chain A, The Crystal Structure Of The Nbd1 Domain Of The Mouse Cftr Protein, Deltaf508 Mutant Length = 285 Back     alignment and structure
>pdb|1YQT|A Chain A, Rnase-L Inhibitor Length = 538 Back     alignment and structure
>pdb|1XMI|A Chain A, Crystal Structure Of Human F508a Nbd1 Domain With Atp Length = 291 Back     alignment and structure
>pdb|1XFA|A Chain A, Structure Of Nbd1 From Murine Cftr- F508r Mutant Length = 283 Back     alignment and structure
>pdb|1XF9|A Chain A, Structure Of Nbd1 From Murine Cftr- F508s Mutant Length = 283 Back     alignment and structure
>pdb|1G9X|A Chain A, Characterization Of The Twinning Structure Of Mj1267, An Atp-Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|2D2E|A Chain A, Crystal Structure Of Atypical Cytoplasmic Abc-Atpase Sufc From Thermus Thermophilus Hb8 Length = 250 Back     alignment and structure
>pdb|2IHY|A Chain A, Structure Of The Staphylococcus Aureus Putative Atpase Subunit Of An Atp-Binding Cassette (Abc) Transporter Length = 279 Back     alignment and structure
>pdb|2BBO|A Chain A, Human Nbd1 With Phe508 Length = 291 Back     alignment and structure
>pdb|1XMJ|A Chain A, Crystal Structure Of Human Deltaf508 Human Nbd1 Domain With Atp Length = 290 Back     alignment and structure
>pdb|3BK7|A Chain A, Structure Of The Complete Abce1RNAASE-L Inhibitor Protein From Pyrococcus Abysii Length = 607 Back     alignment and structure
>pdb|3J16|B Chain B, Models Of Ribosome-Bound Dom34p And Rli1p And Their Ribosomal Binding Partners Length = 608 Back     alignment and structure
>pdb|3J15|B Chain B, Model Of Ribosome-Bound Archaeal Pelota And Abce1 Length = 593 Back     alignment and structure
>pdb|4FWI|B Chain B, Crystal Structure Of The Nucleotide-binding Domain Of A Dipeptide Abc Transporter Length = 334 Back     alignment and structure
>pdb|2CBZ|A Chain A, Structure Of The Human Multidrug Resistance Protein 1 Nucleotide Binding Domain 1 Length = 237 Back     alignment and structure
>pdb|3GD7|A Chain A, Crystal Structure Of Human Nbd2 Complexed With N6- Phenylethyl-Atp (P-Atp) Length = 390 Back     alignment and structure
>pdb|3PIH|A Chain A, T. Maritima Uvra In Complex With Fluorescein-Modified Dna Length = 916 Back     alignment and structure
>pdb|3OZX|A Chain A, Crystal Structure Of Abce1 Of Sulfolubus Solfataricus (-Fes Domain) Length = 538 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query650
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 5e-38
1sgw_A214 Putative ABC transporter; structural genomics, P p 5e-38
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 2e-35
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 9e-32
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 1e-31
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 4e-31
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 4e-31
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 9e-31
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 3e-27
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 1e-30
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 1e-30
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 7e-30
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 2e-24
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 9e-30
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 1e-29
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 1e-29
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 5e-27
2ghi_A260 Transport protein; multidrug resistance protein, M 2e-29
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 4e-29
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 1e-28
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 3e-26
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 2e-28
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 2e-27
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 2e-27
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 5e-26
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 9e-25
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 1e-25
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 3e-25
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 5e-25
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 9e-25
1b0u_A262 Histidine permease; ABC transporter, transport pro 1e-24
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 1e-23
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 2e-23
1g6h_A257 High-affinity branched-chain amino acid transport 4e-23
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 7e-23
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 7e-23
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 6e-21
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 1e-20
1ji0_A240 ABC transporter; ATP binding protein, structural g 4e-20
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 5e-20
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 6e-20
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 9e-20
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 3e-18
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 3e-17
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 2e-16
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 3e-16
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 2e-06
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 3e-06
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 5e-16
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 2e-15
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 3e-15
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 6e-14
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 2e-13
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 6e-12
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 1e-09
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 2e-08
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
 Score =  140 bits (356), Expect = 5e-38
 Identities = 47/185 (25%), Positives = 87/185 (47%), Gaps = 15/185 (8%)

Query: 173 LNGITGSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSK---SLKS 229
           L GI+  +  GE+  L+GP+G+GKTT L ++S  L++P+  G +T       +    ++ 
Sbjct: 31  LKGISFEIEEGEIFGLIGPNGAGKTTTLRIIST-LIKPS-SGIVTVFGKNVVEEPHEVRK 88

Query: 230 KIGFVTQDDVLFPHLTVKETLTY-AALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMI 288
            I ++ ++   + ++   E L + A            + E+         GL        
Sbjct: 89  LISYLPEEAGAYRNMQGIEYLRFVAGFYASS----SSEIEEMVERATEIAGLGEKIK--- 141

Query: 289 GGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTV 348
               V   S G  +++ I   +++NP L  LDEPTSGLD   A  + ++L+  ++ G T+
Sbjct: 142 --DRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTI 199

Query: 349 VTTIH 353
           + + H
Sbjct: 200 LVSSH 204


>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Length = 267 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Length = 250 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Length = 381 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Length = 148 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query650
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 100.0
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 100.0
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 100.0
1b0u_A262 Histidine permease; ABC transporter, transport pro 100.0
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 100.0
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 100.0
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 100.0
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 100.0
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 100.0
1g6h_A257 High-affinity branched-chain amino acid transport 100.0
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 100.0
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 100.0
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 100.0
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 100.0
1ji0_A240 ABC transporter; ATP binding protein, structural g 100.0
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 100.0
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 100.0
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 100.0
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 100.0
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 100.0
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 100.0
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 100.0
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 100.0
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 100.0
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 100.0
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 100.0
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 100.0
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 100.0
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 100.0
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 100.0
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 100.0
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 100.0
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 100.0
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 100.0
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 100.0
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 100.0
2ghi_A260 Transport protein; multidrug resistance protein, M 100.0
1sgw_A214 Putative ABC transporter; structural genomics, P p 100.0
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 100.0
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 100.0
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 100.0
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 100.0
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 100.0
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 100.0
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 100.0
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 100.0
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 100.0
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 100.0
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 100.0
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 100.0
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 100.0
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 100.0
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 100.0
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 100.0
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.97
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.97
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.97
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.97
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.97
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 99.97
4aby_A415 DNA repair protein RECN; hydrolase, double strand 99.96
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.95
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 99.93
1e69_A322 Chromosome segregation SMC protein; structural mai 99.92
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.92
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 99.92
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.91
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 99.9
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 99.88
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.88
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 99.87
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 99.87
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.86
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 99.85
2og2_A359 Putative signal recognition particle receptor; nuc 99.84
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.84
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 99.84
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.84
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 99.83
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.82
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.82
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 99.82
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.82
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 99.81
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 99.79
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 99.79
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.78
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.77
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.77
2eyu_A261 Twitching motility protein PILT; pilus retraction 99.76
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 99.76
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 99.76
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 99.76
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 99.75
4a74_A231 DNA repair and recombination protein RADA; hydrola 99.75
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.72
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.72
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 99.71
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 99.71
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 99.7
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 99.7
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 99.69
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 99.69
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 99.68
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 99.67
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 99.66
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.65
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 99.65
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 99.63
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.6
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 99.57
3kta_B173 Chromosome segregation protein SMC; structural mai 99.57
2cvh_A220 DNA repair and recombination protein RADB; filamen 99.57
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 99.53
2ewv_A372 Twitching motility protein PILT; pilus retraction 99.52
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 99.51
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 99.5
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 99.49
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 99.47
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 99.46
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 99.44
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 99.44
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 99.43
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 99.43
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 99.42
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 99.4
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.4
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 99.39
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 99.37
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 99.34
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 99.33
2kjq_A149 DNAA-related protein; solution structure, NESG, st 99.32
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.3
1p9r_A418 General secretion pathway protein E; bacterial typ 99.3
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.27
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.26
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 99.26
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 99.24
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 99.22
2oap_1511 GSPE-2, type II secretion system protein; hexameri 99.2
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 99.1
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.06
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.06
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 99.06
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 99.02
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 99.01
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.01
1vma_A306 Cell division protein FTSY; TM0570, structural gen 98.96
2r6a_A454 DNAB helicase, replicative helicase; replication, 98.93
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 98.89
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 98.89
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.84
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 98.83
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 98.82
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 98.82
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.82
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 98.8
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.8
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 98.78
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.61
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 98.61
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 98.56
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 98.54
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 98.5
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.48
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 98.48
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 98.44
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 98.39
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 98.35
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 98.25
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 98.25
3kta_A182 Chromosome segregation protein SMC; structural mai 98.25
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 98.24
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 98.22
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 98.22
3vaa_A199 Shikimate kinase, SK; structural genomics, center 98.21
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 98.16
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 98.14
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 98.13
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 98.13
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 98.13
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 98.07
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 98.04
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 98.04
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 98.04
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 98.0
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 97.98
2z43_A324 DNA repair and recombination protein RADA; archaea 97.97
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.94
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.89
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.82
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.81
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 97.79
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 97.76
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.71
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 97.62
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 97.61
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.6
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 97.54
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 97.54
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 97.5
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 97.5
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.46
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 97.45
3ice_A422 Transcription termination factor RHO; transcriptio 97.45
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.45
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.42
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 97.42
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 97.3
3lxx_A239 GTPase IMAP family member 4; structural genomics c 97.26
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.24
1u94_A356 RECA protein, recombinase A; homologous recombinat 97.24
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 97.23
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 97.18
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 97.16
3bos_A242 Putative DNA replication factor; P-loop containing 97.1
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.09
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 97.08
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 97.06
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 97.05
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 97.02
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.02
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 97.01
2www_A349 Methylmalonic aciduria type A protein, mitochondri 97.0
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 96.99
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.99
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.98
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 96.96
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.87
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 96.86
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.83
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 96.79
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.74
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 96.73
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 96.72
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 96.67
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.61
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 96.57
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.48
2v1u_A387 Cell division control protein 6 homolog; DNA repli 96.46
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 96.44
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.4
2wji_A165 Ferrous iron transport protein B homolog; membrane 96.4
3lxw_A247 GTPase IMAP family member 1; immunity, structural 96.4
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.39
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 96.39
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 96.31
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 96.28
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.24
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.22
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 96.19
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 96.17
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.12
1xp8_A366 RECA protein, recombinase A; recombination, radior 96.11
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 96.1
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.08
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 96.06
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.05
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 95.98
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 95.97
3r20_A233 Cytidylate kinase; structural genomics, seattle st 95.97
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 95.96
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 95.96
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 95.88
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 95.87
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 95.8
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 95.79
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 95.78
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 95.78
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 95.76
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 95.75
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.73
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 95.73
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 95.7
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 95.68
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 95.66
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 95.62
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 95.57
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 95.57
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 95.54
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 95.51
1via_A175 Shikimate kinase; structural genomics, transferase 95.46
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 95.44
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 95.43
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 95.38
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 95.38
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 95.32
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 95.2
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 95.19
1xjc_A169 MOBB protein homolog; structural genomics, midwest 95.17
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 95.14
2ged_A193 SR-beta, signal recognition particle receptor beta 95.13
2vli_A183 Antibiotic resistance protein; transferase, tunica 95.1
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 95.07
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 95.07
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 95.04
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.04
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 95.02
3co5_A143 Putative two-component system transcriptional RES 94.99
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 94.97
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 94.97
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 94.94
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 94.92
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 94.9
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 94.9
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 94.88
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 94.87
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 94.86
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 94.82
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 94.81
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 94.81
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 94.81
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 94.8
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 94.79
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 94.78
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 94.78
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 94.78
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 94.77
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 94.77
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 94.75
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 94.74
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 94.71
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 94.7
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 94.69
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 94.66
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 94.65
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 94.65
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 94.64
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 94.62
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 94.62
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 94.61
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 94.6
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 94.59
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 94.59
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 94.58
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 94.58
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 94.58
1jal_A363 YCHF protein; nucleotide-binding fold, structural 94.56
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 94.56
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 94.52
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 94.52
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 94.52
3t1o_A198 Gliding protein MGLA; G domain containing protein, 94.51
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 94.51
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 94.5
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 94.48
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 94.47
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 94.43
3tlx_A243 Adenylate kinase 2; structural genomics, structura 94.39
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 94.36
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 94.34
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 94.32
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 94.3
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 94.3
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 94.3
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 94.26
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 94.24
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 94.24
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 94.23
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 94.2
1nrj_B218 SR-beta, signal recognition particle receptor beta 94.15
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 94.15
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 94.15
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 94.14
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 94.13
3iby_A256 Ferrous iron transport protein B; G protein, G dom 94.1
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 94.1
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 94.09
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 94.06
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 94.05
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 94.04
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 94.02
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 94.02
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 94.01
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 94.0
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 93.99
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 93.98
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 93.97
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 93.96
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 93.95
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 93.95
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 93.94
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 93.94
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 93.93
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 93.92
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 93.89
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 93.87
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 93.86
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 93.85
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 93.84
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 93.84
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 93.81
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 93.79
3llu_A196 RAS-related GTP-binding protein C; structural geno 93.79
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 93.77
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 93.76
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 93.76
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 93.75
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 93.73
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 93.72
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 93.7
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 93.7
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 93.69
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 93.68
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 93.67
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 93.67
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 93.65
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 93.65
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 93.65
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 93.63
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 93.63
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 93.63
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 93.62
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 93.6
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 93.59
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 93.58
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 93.58
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 93.58
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 93.58
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 93.54
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 93.54
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 93.49
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 93.48
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 93.47
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 93.41
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 93.4
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 93.35
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 93.3
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 93.25
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 93.24
2fh5_B214 SR-beta, signal recognition particle receptor beta 93.23
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 93.21
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 93.21
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 93.2
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 93.19
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 93.18
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 93.16
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 93.12
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 93.12
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 93.09
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 93.05
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 93.05
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 93.04
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 93.01
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 92.99
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 92.95
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 92.91
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 92.88
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 92.87
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 92.85
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 92.84
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 92.79
2hf9_A226 Probable hydrogenase nickel incorporation protein 92.75
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 92.7
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 92.63
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 92.57
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 92.51
3cnl_A262 YLQF, putative uncharacterized protein; circular p 92.49
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 92.45
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 92.44
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 92.43
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 92.39
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 92.36
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 92.3
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 92.28
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 92.21
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 92.19
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 92.09
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 92.05
2r62_A268 Cell division protease FTSH homolog; ATPase domain 91.95
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 91.91
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 91.84
2eyu_A261 Twitching motility protein PILT; pilus retraction 91.79
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 91.71
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 91.49
2chg_A226 Replication factor C small subunit; DNA-binding pr 91.27
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 91.22
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 91.2
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 91.14
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 91.11
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 91.08
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 91.0
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 90.95
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 90.86
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 90.8
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 90.11
1wxq_A397 GTP-binding protein; structural genomics, riken st 90.56
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 90.43
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 90.4
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 90.37
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 90.22
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 90.21
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 90.19
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 90.18
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 90.07
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 90.03
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 89.98
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
Probab=100.00  E-value=6e-50  Score=428.89  Aligned_cols=222  Identities=24%  Similarity=0.402  Sum_probs=196.4

Q ss_pred             eeEEEEeEEEEEeeccccccccccceeceEEEEeCCeEEEEECCCCCcHHHHHHHHHcCCCCCCcceEEEECCEeCCh--
Q 006335          148 IYLKFTDVTYKVILKGMTSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSK--  225 (650)
Q Consensus       148 ~~l~~~nvs~~~~~~~~~~~~~~~iL~~vs~~i~~Ge~~aIvGpsGsGKSTLL~~L~G~~~~~~~~G~I~~~G~~~~~--  225 (650)
                      ..|+++||+++|..+    .+..++|+||||+|++||++||+||||||||||+|+|+|...  +++|+|.++|+++..  
T Consensus        23 ~mi~v~~ls~~y~~~----~~~~~aL~~vsl~i~~Gei~~IiGpnGaGKSTLlr~i~GL~~--p~~G~I~i~G~~i~~~~   96 (366)
T 3tui_C           23 HMIKLSNITKVFHQG----TRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLER--PTEGSVLVDGQELTTLS   96 (366)
T ss_dssp             CCEEEEEEEEEEECS----SSEEEEEEEEEEEECTTCEEEEECCTTSSHHHHHHHHHTSSC--CSEEEEEETTEECSSCC
T ss_pred             ceEEEEeEEEEeCCC----CCCeEEEEeeEEEEcCCCEEEEEcCCCchHHHHHHHHhcCCC--CCceEEEECCEECCcCC
Confidence            369999999999421    124579999999999999999999999999999999999543  568999999999852  


Q ss_pred             -----hccCcEEEEccCCcCCCCCCHHHHHHHHHhccCCCCccHHHHHHHHHHHHHHcCCCccccccccCccCCCCCHHH
Q 006335          226 -----SLKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVSGGE  300 (650)
Q Consensus       226 -----~~~~~i~yV~Q~~~l~~~lTV~enl~~~~~~~~~~~~~~~~~~~~v~~~l~~lgL~~~~~t~vg~~~~~~LSGGe  300 (650)
                           ..|++||||||++.+++.+||+||+.|+...+   ..++++.++++.++++.+||.+..+.     ++.+|||||
T Consensus        97 ~~~~~~~r~~Ig~v~Q~~~l~~~~TV~env~~~~~~~---~~~~~~~~~~v~~lL~~vgL~~~~~~-----~~~~LSGGq  168 (366)
T 3tui_C           97 ESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELD---NTPKDEVKRRVTELLSLVGLGDKHDS-----YPSNLSGGQ  168 (366)
T ss_dssp             HHHHHHHHTTEEEECSSCCCCTTSCHHHHHHHHHHHS---CCCHHHHHHHHHHHHHHHTCGGGTTC-----CTTTSCHHH
T ss_pred             HHHHHHHhCcEEEEeCCCccCCCCCHHHHHHHHHHhc---CCCHHHHHHHHHHHHHHcCCchHhcC-----ChhhCCHHH
Confidence                 24678999999999999999999999987654   24567778889999999999876665     457899999


Q ss_pred             HHHHHHHHHHhhCCCEEEEeCCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEEecCCChHHHhhcCEEEEEeCCeEEEecC
Q 006335          301 RKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEA-GKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGK  379 (650)
Q Consensus       301 rqRv~IA~aL~~~P~iLlLDEPTsgLD~~s~~~i~~~L~~l~~~-g~TvI~~~H~~~~~i~~~~D~iivL~~G~iv~~G~  379 (650)
                      ||||+|||||+.+|+||||||||||||+.++..+++.|++++++ |+|||++||++. .+.++||||++|++|++++.|+
T Consensus       169 kQRVaIArAL~~~P~lLLlDEPTs~LD~~~~~~i~~lL~~l~~~~g~Tii~vTHdl~-~~~~~aDrv~vl~~G~iv~~g~  247 (366)
T 3tui_C          169 KQRVAIARALASNPKVLLCDQATSALDPATTRSILELLKDINRRLGLTILLITHEMD-VVKRICDCVAVISNGELIEQDT  247 (366)
T ss_dssp             HHHHHHHHHTTTCCSEEEEESTTTTSCHHHHHHHHHHHHHHHHHSCCEEEEEESCHH-HHHHHCSEEEEEETTEEEECCB
T ss_pred             HHHHHHHHHHhcCCCEEEEECCCccCCHHHHHHHHHHHHHHHHhCCCEEEEEecCHH-HHHHhCCEEEEEECCEEEEEcC
Confidence            99999999999999999999999999999999999999999754 999999999975 5778999999999999999999


Q ss_pred             HHHHH
Q 006335          380 ASEAM  384 (650)
Q Consensus       380 ~~~~~  384 (650)
                      +++++
T Consensus       248 ~~ev~  252 (366)
T 3tui_C          248 VSEVF  252 (366)
T ss_dssp             HHHHH
T ss_pred             HHHHH
Confidence            99975



>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 650
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 2e-42
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 2e-41
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 5e-40
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 9e-40
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 9e-39
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 1e-38
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 1e-37
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 3e-37
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 5e-37
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 9e-37
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 1e-36
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 4e-35
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 5e-35
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 2e-33
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 4e-32
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 1e-30
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 1e-30
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 7e-30
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 1e-28
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 6e-25
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 8e-11
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 2e-10
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 1e-09
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 1e-05
d1znwa1182 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacteriu 2e-05
d1w1wa_427 c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac 6e-05
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 1e-04
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 1e-04
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 3e-04
d1s96a_205 c.37.1.1 (A:) Guanylate kinase {Escherichia coli [ 4e-04
d1np6a_170 c.37.1.10 (A:) Molybdopterin-guanine dinucleotide 7e-04
d1knqa_171 c.37.1.17 (A:) Gluconate kinase {Escherichia coli 8e-04
d1m8pa3183 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal d 9e-04
d1rz3a_198 c.37.1.6 (A:) Hypothetical protein rbstp0775 {Baci 0.001
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 0.002
d1f5na2277 c.37.1.8 (A:7-283) Interferon-induced guanylate-bi 0.002
d1x6va3195 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kin 0.003
d1kaga_169 c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia 0.003
d2bdta1176 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {B 0.004
d1xjca_165 c.37.1.10 (A:) Molybdopterin-guanine dinucleotide 0.004
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: MJ0796
species: Archaeon Methanococcus jannaschii [TaxId: 2190]
 Score =  150 bits (381), Expect = 2e-42
 Identities = 65/224 (29%), Positives = 111/224 (49%), Gaps = 17/224 (7%)

Query: 165 TSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYS 224
              E    L  +  ++  GE +++MGPSGSGK+T+LN++   L +PT  G +  ++   +
Sbjct: 13  MGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGC-LDKPT-EGEVYIDNIKTN 70

Query: 225 --------KSLKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVIN 276
                   K  + KIGFV Q   L P LT  E +    + +    ++ +++ KRA++ + 
Sbjct: 71  DLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEERRKRALECLK 130

Query: 277 ELGLERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQ 336
              LE              +SGG+++RV I   +  NP ++  D+PT  LDS T  +I+Q
Sbjct: 131 MAELEE----RFANHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQ 186

Query: 337 MLQDIA-EAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGK 379
           +L+ +  E GKTVV   H  +  +    +++I L  G +    K
Sbjct: 187 LLKKLNEEDGKTVVVVTHDIN--VARFGERIIYLKDGEVEREEK 228


>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 182 Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Length = 205 Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Length = 170 Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 183 Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Length = 198 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Length = 195 Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Length = 169 Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Length = 176 Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Length = 165 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query650
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 100.0
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.84
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.63
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.56
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 99.09
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.83
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 98.74
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 97.86
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 97.79
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.55
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 97.27
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.04
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.03
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.03
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.98
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.9
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.86
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.8
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.75
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.74
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.64
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.55
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.5
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.47
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.43
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.43
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.35
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.32
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.31
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.31
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 96.31
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.27
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.22
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.17
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.14
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.12
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.0
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.94
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 95.92
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.92
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.92
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 95.91
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.9
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.84
d1nrjb_209 Signal recognition particle receptor beta-subunit 95.83
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.73
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.72
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.72
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.68
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 95.67
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.66
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.64
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 95.6
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.57
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.54
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.53
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.53
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 95.53
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.49
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.48
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.45
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.44
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.4
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.4
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.4
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.32
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.3
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 95.24
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.21
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.18
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.13
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 95.11
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 95.1
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.05
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.01
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.01
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.0
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.85
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.84
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 94.78
d2fh5b1207 Signal recognition particle receptor beta-subunit 94.77
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 94.77
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 94.76
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 94.7
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.69
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.6
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.58
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 94.53
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 94.49
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.46
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.31
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 94.24
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 94.22
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 94.15
d1okkd2207 GTPase domain of the signal recognition particle r 94.07
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.03
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.01
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 93.94
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 93.92
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.89
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 93.89
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 93.81
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 93.8
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 93.76
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 93.73
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 93.72
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 93.7
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 93.59
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 93.55
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 93.49
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 93.48
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 93.47
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 93.45
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 93.44
d1ls1a2207 GTPase domain of the signal sequence recognition p 93.3
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 93.3
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 93.24
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 93.22
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 93.22
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 93.18
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.17
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 93.17
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 93.15
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 93.13
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 93.11
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 93.06
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 92.97
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.91
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 92.9
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 92.89
d1vmaa2213 GTPase domain of the signal recognition particle r 92.84
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 92.81
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 92.74
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 92.72
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 92.67
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 92.67
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 92.65
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 92.64
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 92.63
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.61
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 92.61
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 92.51
d2qy9a2211 GTPase domain of the signal recognition particle r 92.47
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 92.47
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.46
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 92.46
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 92.39
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 92.36
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 92.35
d1j8yf2211 GTPase domain of the signal sequence recognition p 92.34
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 92.33
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 92.32
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 92.05
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 92.03
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 91.99
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.91
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 91.88
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 91.86
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 91.76
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 91.73
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 91.69
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 91.68
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 91.66
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 91.61
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 91.47
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 91.43
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 91.4
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 91.39
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 91.34
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 91.32
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 91.22
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 91.11
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 91.04
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 91.0
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 90.89
d1xpua3289 Transcription termination factor Rho, ATPase domai 90.77
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 90.58
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 90.55
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 90.52
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 90.39
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 90.27
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 90.24
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 90.23
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 90.14
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 89.94
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 89.92
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 89.81
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 89.46
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 89.34
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 89.06
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 88.63
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 88.61
d1svma_362 Papillomavirus large T antigen helicase domain {Si 87.61
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 87.49
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 87.47
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 87.37
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 87.34
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 87.18
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 86.59
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 86.47
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 86.23
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 86.02
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 85.78
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 85.77
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 85.74
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 85.62
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 84.68
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 84.38
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 83.65
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 82.81
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 82.8
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 82.79
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 82.43
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 81.65
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 80.96
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]
Probab=100.00  E-value=1.4e-55  Score=443.64  Aligned_cols=217  Identities=26%  Similarity=0.475  Sum_probs=191.3

Q ss_pred             eEEEEeEEEEEeeccccccccccceeceEEEEeCCeEEEEECCCCCcHHHHHHHHHcCCCCCCcceEEEECCEeCCh--h
Q 006335          149 YLKFTDVTYKVILKGMTSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSK--S  226 (650)
Q Consensus       149 ~l~~~nvs~~~~~~~~~~~~~~~iL~~vs~~i~~Ge~~aIvGpsGsGKSTLL~~L~G~~~~~~~~G~I~~~G~~~~~--~  226 (650)
                      .|+++||+++|        +++.+|+||||+|++||+++|+||||||||||+|+|+|.+.  +++|+|.+||+++.+  .
T Consensus         6 ~I~v~nlsk~y--------g~~~al~~vsl~v~~Ge~~~liGpsGaGKSTLl~~i~Gl~~--p~sG~I~i~g~~i~~~~~   75 (239)
T d1v43a3           6 EVKLENLTKRF--------GNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEE--PTEGRIYFGDRDVTYLPP   75 (239)
T ss_dssp             CEEEEEEEEEE--------TTEEEEEEEEEEECTTCEEEEECCTTSSHHHHHHHHHTSSC--CSEEEEEETTEECTTSCG
T ss_pred             eEEEEEEEEEE--------CCEEEEcceeEEECCCCEEEEECCCCChHHHHHHHHHcCCC--CCCCEEEEcceecccCCc
Confidence            48999999999        46789999999999999999999999999999999999653  468999999999863  4


Q ss_pred             ccCcEEEEccCCcCCCCCCHHHHHHHHHhccCCCCccHHHHHHHHHHHHHHcCCCccccccccCccCCCCCHHHHHHHHH
Q 006335          227 LKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVSGGERKRVCI  306 (650)
Q Consensus       227 ~~~~i~yV~Q~~~l~~~lTV~enl~~~~~~~~~~~~~~~~~~~~v~~~l~~lgL~~~~~t~vg~~~~~~LSGGerqRv~I  306 (650)
                      .+++||||||++.+|+++||+||+.|+...+   ..++++.+++++++++.+||++..|.     ++.+|||||||||+|
T Consensus        76 ~~r~ig~v~Q~~~l~~~ltv~enl~~~~~~~---~~~~~~~~~~~~~~l~~~~l~~~~~~-----~~~~LSGGq~QRvai  147 (239)
T d1v43a3          76 KDRNISMVFQSYAVWPHMTVYENIAFPLKIK---KFPKDEIDKRVRWAAELLQIEELLNR-----YPAQLSGGQRQRVAV  147 (239)
T ss_dssp             GGGTEEEEEC------CCCHHHHHHTTCC-----CCCHHHHHHHHHHHHHHTTCGGGTTS-----CTTTCCSSCHHHHHH
T ss_pred             ccceEEEEeechhhcccchHHHHHHHHHHHc---CCCHHHHHHHHHHHHHHcCChhhhcC-----ChhhCCHHHHHHHHH
Confidence            5678999999999999999999999987554   46788889999999999999877665     467999999999999


Q ss_pred             HHHHhhCCCEEEEeCCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEEecCCChHHHhhcCEEEEEeCCeEEEecCHHHHH
Q 006335          307 GNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEA-GKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAM  384 (650)
Q Consensus       307 A~aL~~~P~iLlLDEPTsgLD~~s~~~i~~~L~~l~~~-g~TvI~~~H~~~~~i~~~~D~iivL~~G~iv~~G~~~~~~  384 (650)
                      ||||+.+|+||||||||+|||+.++.++++.|+++.++ |+|||++|||+. ++.++||||++|++|+|++.|+++++.
T Consensus       148 AraL~~~P~iLllDEPts~LD~~~~~~i~~ll~~l~~~~g~tii~vTHd~~-~a~~~~dri~vm~~G~iv~~G~~~el~  225 (239)
T d1v43a3         148 ARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQV-EAMTMGDRIAVMNRGQLLQIGSPTEVY  225 (239)
T ss_dssp             HHHHTTCCSEEEEESTTTTSCHHHHHHHHHHHHHHHHHHTCEEEEEESCHH-HHHHHCSEEEEEETTEEEEEECHHHHH
T ss_pred             HhhhccCCCceeecCCcccCCHHHHHHHHHHHHHHHHhcCCeEEEEeCCHH-HHHHhCCEEEEEECCEEEEEcCHHHHH
Confidence            99999999999999999999999999999999999765 999999999975 588999999999999999999999985



>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure