BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 006338
         (650 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1TVC|A Chain A, Fad And Nadh Binding Domain Of Methane Monooxygenase
           Reductase From Methylococcus Capsulatus (Bath)
          Length = 250

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%)

Query: 159 ATVDCLEDEAWNLLRDSMVYYCGSPIGTIAANDPTSSNVLNYDQVFIRDFIPSGIA 214
           + +D L ++  +   +  +Y CG P    AA +   S  +  +QVF   F+PSG A
Sbjct: 195 SPIDALREDLESSDANPDIYLCGPPGMIDAACELVRSRGIPGEQVFFEKFLPSGAA 250


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.136    0.421 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 20,000,950
Number of Sequences: 62578
Number of extensions: 841848
Number of successful extensions: 1829
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1823
Number of HSP's gapped (non-prelim): 6
length of query: 650
length of database: 14,973,337
effective HSP length: 105
effective length of query: 545
effective length of database: 8,402,647
effective search space: 4579442615
effective search space used: 4579442615
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)