BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 006348
(649 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3TIQ|A Chain A, Crystal Structure Of Staphylococcus Aureus Sasg G51-E-G52
Module
pdb|3TIQ|B Chain B, Crystal Structure Of Staphylococcus Aureus Sasg G51-E-G52
Module
Length = 214
Score = 32.0 bits (71), Expect = 1.1, Method: Composition-based stats.
Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 6/45 (13%)
Query: 554 PTNRVDAPGPE------RSENNNPDRVGNTMEIPGQPDLQQPETG 592
P N + GPE R E + G E+PG+P ++ PETG
Sbjct: 75 PINELTEYGPETIAPGHRDEFDPKLPTGEKEEVPGKPGIKNPETG 119
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.138 0.424
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 17,903,873
Number of Sequences: 62578
Number of extensions: 691814
Number of successful extensions: 1578
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1578
Number of HSP's gapped (non-prelim): 1
length of query: 649
length of database: 14,973,337
effective HSP length: 105
effective length of query: 544
effective length of database: 8,402,647
effective search space: 4571039968
effective search space used: 4571039968
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 55 (25.8 bits)