Citrus Sinensis ID: 006433

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-----
MKRAKLESVLPLSRLRMIQFLMGILFLYLLFMSFEIPFVFKSDTGSVGFFADTLPKHVLLENEAEELYTASRPSKDTSASTYQTFSRAPERRMREFKRVSGLFFNESALDDSESNIDEFSVLHKIAKDAWSVGKKVWDELESAETISKTQIEPNKTKSESCPHSISLSGSDFVNRSHLMVLPCGLTLGSHVTVVGKPHWAHPEDDPKIASLKEGEEAVLVSQFMMELQGLKTVDGEDPPRILHFNPRLKGDWSGRPVIEMNTCYRMQWGSALRCEGWRSRADEETVDGKVKCEKWIRDDDEHSEESKAAWWLNRLIGRTKKVTVEWPYPFSEGNLFVLTIAAGLEGYHITVDGRHVTSFPYRTGFALEDATGLSVNGNVDLHFLFAASLPTSHPSFAPQKHLEMLTKWRAPPLPDGHVELFIGILSAGNHFAERMAVRKSWMQHKLITSSKVVARFFVALHGRKEVNLDLKKEAEYFGDIVIVRTVAANYIMKCDDDTFIRVDAVMKEARKVREDKSLYIGNMNYYHRPLRHGKWAVTYEEWPEEEYPPYANGPGYIVSSDIAQFIVADFEKHKLRLFKMEDVSMGMWVEKFNNSKPVEYVHSLKFCQFGCIEDYYTAHYQSPRQMVCMWDKLQNQGKPQCCNMR
ccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccECcccccccccccccccccHHccccHHHcccccccccccccccccccccccHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEcccccccccCEEEEEcccccccEEEEEccccccccccccHHHccccccccEEEEEEEEEEccccccccccccEEEEEccccccccccccEEEECcccccccccccccccccccccccccccHHHHHHHHcccccccHHHHHHcHHHHccccccccccccccccccccEEEEEEEcccccEEEEEcccccccccccccccccccccEEEcccccHHHHHcccccccccccccHHHHHHcccccccccccccEEEEEEEEcccccHHHHHHHHHHcccccccccccEEEEEEEEEcccHHHHHHHHHHHHHcccEEEEEcccEEEEEECcccEEEcHHHHHHHHHcccccccEEEEEEcccccccccccccccccccccccccccccccCEEEcHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccccccccccccccccccEEEEccccHHHHHHHHHHHHccccccccccc
*********LPLSRLRMIQFLMGILFLYLLFMSFEIPFVFKSDTGSVGFFAD***************************************************FNESALDD*ESNIDEFSVLHKIAKDAWSVGKKVWDEL******************************DFVNRSHLMVLPCGLTLGSHVTVVGKPHWAHPEDDPK*****EGEEAVLVSQFMMELQGLKTVDGEDPPRILHFNPRLKGDWSGRPVIEMNTCYRMQWGSALRCE**********VDGKVKCEKWIRD********KAAWWLNRLIGRTKKVTVEWPYPFSEGNLFVLTIAAGLEGYHITVDGRHVTSFPYRTGFALEDATGLSVNGNVDLHFLFAASLPTSHPSFAPQKHLEMLTKWRAPPLPDGHVELFIGILSAGNHFAERMAVRKSWMQHKLITSSKVVARFFVALHGRKEVNLDLKKEAEYFGDIVIVRTVAANYIMKCDDDTFIRVDAVMKEARKVREDKSLYIGNMNYYHRPLRHGKWAVTYEEWPEEEYPPYANGPGYIVSSDIAQFIVADFEKHKLRLFKMEDVSMGMWVEKFNNSKPVEYVHSLKFCQFGCIEDYYTAHYQSPRQMVCMWDKLQNQGKPQCC***
xxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRAKLESVLPLSRLRMIQFLMGILFLYLLFMSFEIPFVFKSDTGSVGFFADTLPKHVLLENEAEELYTASRPSKDTSASTYQTFSRAPERRMREFKRVSGLFFNESALDDSESNIDEFSVLHKIAKDAWSVGKKVWDELESAETISKTQIEPNKTKSESCPHSISLSGSDFVNRSHLMVLPCGLTLGSHVTVVGKPHWAHPEDDPKIASLKEGEEAVLVSQFMMELQGLKTVDGEDPPRILHFNPRLKGDWSGRPVIEMNTCYRMQWGSALRCEGWRSRADEETVDGKVKCEKWIRDDDEHSEESKAAWWLNRLIGRTKKVTVEWPYPFSEGNLFVLTIAAGLEGYHITVDGRHVTSFPYRTGFALEDATGLSVNGNVDLHFLFAASLPTSHPSFAPQKHLEMLTKWRAPPLPDGHVELFIGILSAGNHFAERMAVRKSWMQHKLITSSKVVARFFVALHGRKEVNLDLKKEAEYFGDIVIVRTVAANYIMKCDDDTFIRVDAVMKEARKVREDKSLYIGNMNYYHRPLRHGKWAVTYEEWPEEEYPPYANGPGYIVSSDIAQFIVADFEKHKLRLFKMEDVSMGMWVEKFNNSKPVEYVHSLKFCQFGCIEDYYTAHYQSPRQMVCMWDKLQNQGKPQCCNMR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable beta-1,3-galactosyltransferase 19 Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.probableQ9LV16

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WSU, chain A
Confidence level:very confident
Coverage over the Query: 220-274,326-391
View the alignment between query and template
View the model in PyMOL
Template: 2J0A, chain A
Confidence level:confident
Coverage over the Query: 416-526,547-595
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3naj, chain Aprobable Alignment | Template Structure
3naj, chain Aprobable Alignment | Template Structure