Citrus Sinensis ID: 006484


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640---
MDSTDSSRAFVKDVKRLVVKVGTAVVTRSDGRLALGRLGALLEQLKELNSQGFEIILVSSGAVGVGRQRLRYRKLVNSSLADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSSQLLVTDSDFRDEDFRKQLYDTVQSLLDLRVIPIFNENDAVSTRKAPYEDSSGIFWDNDSLAGLLALELKADLLVLLSDVEGLYSGPPSEPNSKLIHTYIRAKHQAEITFGDKSRVGRGGMTAKVNAAYCAACAGIPVVITSGFAMDSIIKVLEGKRVGTLFHRDAHLWVKQVGAREMAVAARESSRRLQALQSQDRRKILLDVADALEANESLIKVENEADVAAAQEAGYAKSLVSRLALKPGKISSLAKSIRILADMEEPIGQILKRTELADGLILEKTSCPLGVLLIVFESRPDALVQIASLAIRSGNGLLLKGGKEAMRSNAILHKVITSAIPDTVGEKLIGLVTSREEIPDLLKLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHADGICHVYVDKSANLDVAKNIVIDAKIDYPAACNAMETLLVHKDLACNGALNELVVELQHEGVGLFGGPRASKLLQIPETRLFHHEYNSMVCTVEIVDDVRAAIDHIHQHGSAHTDCIVAEDQKVAETFLCQVDR
cccccccHHHHccccEEEEEcccEEEEccccccHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHcccHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccHHHHHHHHHHHcccEEEEEcccccccccccccccccEEEEEccccccccEEEccccccccccHHHHHHHHHHHHHcccEEEEcccccccHHHHHccccccccEEccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccHHccccccccHHHHHHHHHHHHHHHccccccccccccEECcccCEEEEEEEccEEEEEEEcccccHHHHHHHHHHHHccEEEccccHHHHHHHHHHHHHHHHHHccccccccEEEccccHHHHHHccccccCEEEEccccHHHHHHHHcccccccccccccccEEEEcccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHcccEEEccHHHHccccccccccHHHHHccccEEEEEEccHHHHHHHHHHccccccccEEcccHHHHHHHHHHHcc
*****SS*AFVKDVKRLVVKVGTAVVTRSDGRLALGRLGALLEQLKELNSQGFEIILVSSGAVGVGRQRLRYRKLVNSSLA*********DGKACAAVGQSSLMALYDTLFSQLDVTSSQLLVTDSDFRDEDFRKQLYDTVQSLLDLRVIPIFNENDAVSTRKAPYEDSSGIFWDNDSLAGLLALELKADLLVLLSDVEGLYSGPPSEPNSKLIHTYIRAKHQAEITFGDKSRVGRGGMTAKVNAAYCAACAGIPVVITSGFAMDSIIKVLEGKRVGTLFHRDAHLWVKQVGA*EMAVAARESSRRLQALQSQDRRKILLDVADALEANESLIKVENEADVAAAQEAGYAKSLVSRLALKPGKISSLAKSIRILADMEEPIGQILKRTELADGLILEKTSCPLGVLLIVFESRPDALVQIASLAIRSGNGLLLKGGKEAMRSNAILHKVITSAIPDTVGEKLIGLVTSREEIPDLLKLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHADGICHVYVDKSANLDVAKNIVIDAKIDYPAACNAMETLLVHKDLACNGALNELVVELQHEGVGLFGGPRASKLLQIPETRLFHHEYNSMVCTVEIVDDVRAAIDHIHQHGSAHTDCIVAEDQKVAETFLCQVD*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSTDSSRAFVKDVKRLVVKVGTAVVTRSDGRLALGRLGALLEQLKELNSQGFEIILVSSGAVGVGRQRLRYRKLVNSSLADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSSQLLVTDSDFRDEDFRKQLYDTVQSLLDLRVIPIFNENDAVSTRKAPYEDSSGIFWDNDSLAGLLALELKADLLVLLSDVEGLYSGPPSEPNSKLIHTYIRAKHQAEITFGDKSRVGRGGMTAKVNAAYCAACAGIPVVITSGFAMDSIIKVLEGKRVGTLFHRDAHLWVKQVGAREMAVAARESSRRLQALQSQDRRKILLDVADALEANESLIKVENEADVAAAQEAGYAKSLVSRLALKPGKISSLAKSIRILADMEEPIGQILKRTELADGLILEKTSCPLGVLLIVFESRPDALVQIASLAIRSGNGLLLKGGKEAMRSNAILHKVITSAIPDTVGEKLIGLVTSREEIPDLLKLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHADGICHVYVDKSANLDVAKNIVIDAKIDYPAACNAMETLLVHKDLACNGALNELVVELQHEGVGLFGGPRASKLLQIPETRLFHHEYNSMVCTVEIVDDVRAAIDHIHQHGSAHTDCIVAEDQKVAETFLCQVDR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Delta-1-pyrroline-5-carboxylate synthase A P5CS plays a key role in proline biosynthesis, leading to osmoregulation in plants.confidentP54887
Delta-1-pyrroline-5-carboxylate synthase P5CS plays a key role in proline biosynthesis, leading to osmoregulation in plants.confidentO04226
Delta-1-pyrroline-5-carboxylate synthase P5CS plays a key role in proline biosynthesis, leading to osmoregulation in plants.probableP32296

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
1.2.-.-Acting on the aldehyde or oxo group of donors.probable
1.2.1.-With NAD(+) or NADP(+) as acceptor.probable
2.7.2.-Phosphotransferases with a carboxyl group as acceptor.probable
2.7.2.11Glutamate 5-kinase.probable
1.2.1.41Glutamate-5-semialdehyde dehydrogenase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2H5G, chain A
Confidence level:very confident
Coverage over the Query: 291-643
View the alignment between query and template
View the model in PyMOL
Template: 2J5V, chain A
Confidence level:very confident
Coverage over the Query: 13-198,239-283
View the alignment between query and template
View the model in PyMOL
Template: 4AXS, chain A
Confidence level:confident
Coverage over the Query: 16-282
View the alignment between query and template
View the model in PyMOL