Citrus Sinensis ID: 006491
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 643 | ||||||
| 225425944 | 603 | PREDICTED: uncharacterized protein LOC10 | 0.891 | 0.950 | 0.617 | 0.0 | |
| 255561737 | 589 | nucleic acid binding protein, putative [ | 0.881 | 0.962 | 0.644 | 0.0 | |
| 225425946 | 587 | PREDICTED: uncharacterized protein LOC10 | 0.880 | 0.964 | 0.586 | 1e-163 | |
| 302398697 | 601 | C2H2L domain class transcription factor | 0.895 | 0.958 | 0.581 | 1e-163 | |
| 449445278 | 618 | PREDICTED: uncharacterized protein LOC10 | 0.900 | 0.936 | 0.556 | 1e-155 | |
| 356575478 | 567 | PREDICTED: zinc finger protein MAGPIE-li | 0.813 | 0.922 | 0.561 | 1e-153 | |
| 356523372 | 533 | PREDICTED: zinc finger protein NUTCRACKE | 0.786 | 0.949 | 0.523 | 1e-148 | |
| 255561735 | 571 | zinc finger protein, putative [Ricinus c | 0.833 | 0.938 | 0.542 | 1e-148 | |
| 224108165 | 530 | predicted protein [Populus trichocarpa] | 0.794 | 0.964 | 0.531 | 1e-147 | |
| 356574629 | 560 | PREDICTED: zinc finger protein NUTCRACKE | 0.838 | 0.962 | 0.503 | 1e-144 |
| >gi|225425944|ref|XP_002268279.1| PREDICTED: uncharacterized protein LOC100251079 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 659 bits (1701), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 406/657 (61%), Positives = 473/657 (71%), Gaps = 84/657 (12%)
Query: 3 MSASSS-APFFEIRED-QNQMKQQHSSTPTSSSAPPPVPPPQKKKRNQPGTPNPDAEVIA 60
M+ASS+ A F IRE+ QNQ+KQQHS+ P+SS+AP P KKKRNQPGTPNPDAEVIA
Sbjct: 1 MAASSTPAQLFGIREEEQNQVKQQHSAVPSSSNAPAAAP--PKKKRNQPGTPNPDAEVIA 58
Query: 61 LSPKTLMATNRFICEVCNKGFQREQNLQLHRRGHNLPWKLKQKTTKEVKRKVYLCPEPTC 120
LSPKTLMATNRFICEVCNKGFQREQNLQLHRRGHNLPWKLKQKTTKEV+RKVYLCPEP C
Sbjct: 59 LSPKTLMATNRFICEVCNKGFQREQNLQLHRRGHNLPWKLKQKTTKEVRRKVYLCPEPGC 118
Query: 121 VHHDPSRALGDLTGIKKHYSRKHGEKKWKCEKCSKRYAVQSDWKAHSKTCGTREYRCDCG 180
VHHDP+RALGDLTGIKKHYSRKHGEKKWKCEKCSKRYAVQSDWKAHSKTCGTREYRCDCG
Sbjct: 119 VHHDPARALGDLTGIKKHYSRKHGEKKWKCEKCSKRYAVQSDWKAHSKTCGTREYRCDCG 178
Query: 181 TLFSRRDSFITHRAFCDALAQESARHQPSLSAIGSHLYASTNNMALGLSQVGPQLSSIKD 240
TLFSRRDSFITHRAFCDALAQESARH +S IGSHLY S+ NM LGLSQVGPQ+SS+ D
Sbjct: 179 TLFSRRDSFITHRAFCDALAQESARHPTPMSTIGSHLYGSS-NMGLGLSQVGPQISSMPD 237
Query: 241 HHQTNQSGDILCLGGSGSRSTPFDHLLSPSMGSSSSSFRPPQSLASTPFFMQESNQNYHE 300
Q++Q GD+L LG G+R+ FDHL+ P++G SSSFR PQ + S F++ E NQ +HE
Sbjct: 238 --QSHQPGDMLRLG--GARAGQFDHLIPPAIG--SSSFRTPQPMPSQAFYIPEPNQEFHE 291
Query: 301 EQQQHQQGLLPNKPPPFHGLMQFADLQNNPNNSNPVTNSAAAANNLFNLSFLSNSSSTNS 360
+QQ GLL NK PFHGL+ DLQNN TN+ ++A NLFNLSF SNSS+TNS
Sbjct: 292 DQQSQHGGLLTNK--PFHGLVHLPDLQNN-------TNNPSSAANLFNLSFFSNSSNTNS 342
Query: 361 LSNSNSNNNNNN---ASNLMLSAAGGHHHHFNNNEQNGTASTGTGGVDHHQGTNNNLFTN 417
+ ++ +N NN+ +S L++S +Q T + G+G NNLF +
Sbjct: 343 MLSNTNNANNSTNMPSSGLLIS------------DQFNTVNGGSG------SERNNLFPS 384
Query: 418 NLISDHQISSGAVPSLFSTSSVHQNETMVPHMSATALLQKAAQMGSTSSNNNTASLLRSF 477
N+I D QISSG VPSLFSTS QNE V HMSATALLQKAAQMGSTSS NN+ASLLR F
Sbjct: 385 NIIGD-QISSG-VPSLFSTSL--QNENAVSHMSATALLQKAAQMGSTSS-NNSASLLRGF 439
Query: 478 GGSSSSSG-SKPNNNNNNFGGAGNVFGGPGSSENDNSSSIHDLMNPFAATNSSIFGTGSN 536
GSSS++ S NFGG VFG +N S + DLMN SS G +
Sbjct: 440 AGSSSANAKSDRPLVGPNFGG---VFG-------ENESHLQDLMN-SLGGGSSSIFGGGS 488
Query: 537 DQVNAFSGQDQ-------NHHR----------RHHHHHPNY----EAKLHHNMNAGMGGS 575
VNA+SG + N +R + H H PN+ E KLH N+ A MGGS
Sbjct: 489 GGVNAYSGHENENTYGGFNANRSTLEQQQQQQQQHRHGPNFCNIDEIKLHQNLTANMGGS 548
Query: 576 DRMTRDFLGVGQIVRSVSGGFQQREKQQQQHGGVIDVSSLDSERNITAPTSQSFGGG 632
DR+TRDFLGVGQ+VR++SGGF QR+ I++S+LDSER+ +A TSQ+FGGG
Sbjct: 549 DRLTRDFLGVGQMVRTISGGFSQRDLPPPG----INISTLDSERS-SAQTSQAFGGG 600
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255561737|ref|XP_002521878.1| nucleic acid binding protein, putative [Ricinus communis] gi|223538916|gb|EEF40514.1| nucleic acid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225425946|ref|XP_002273614.1| PREDICTED: uncharacterized protein LOC100257993 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|302398697|gb|ADL36643.1| C2H2L domain class transcription factor [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|449445278|ref|XP_004140400.1| PREDICTED: uncharacterized protein LOC101219959 [Cucumis sativus] gi|449487889|ref|XP_004157851.1| PREDICTED: uncharacterized protein LOC101227194 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356575478|ref|XP_003555867.1| PREDICTED: zinc finger protein MAGPIE-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356523372|ref|XP_003530314.1| PREDICTED: zinc finger protein NUTCRACKER-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255561735|ref|XP_002521877.1| zinc finger protein, putative [Ricinus communis] gi|223538915|gb|EEF40513.1| zinc finger protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224108165|ref|XP_002314745.1| predicted protein [Populus trichocarpa] gi|222863785|gb|EEF00916.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356574629|ref|XP_003555448.1| PREDICTED: zinc finger protein NUTCRACKER-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 643 | ||||||
| TAIR|locus:2051698 | 602 | IDD5 "AT2G02070" [Arabidopsis | 0.388 | 0.415 | 0.693 | 2.2e-115 | |
| TAIR|locus:2051688 | 516 | IDD4 "indeterminate(ID)-domain | 0.304 | 0.379 | 0.792 | 5.3e-98 | |
| TAIR|locus:2173624 | 500 | IDD1 "AT5G66730" [Arabidopsis | 0.255 | 0.328 | 0.853 | 7.1e-94 | |
| TAIR|locus:2024193 | 506 | MGP "AT1G03840" [Arabidopsis t | 0.270 | 0.343 | 0.806 | 2.1e-93 | |
| TAIR|locus:2204503 | 467 | AT1G14580 "AT1G14580" [Arabido | 0.261 | 0.359 | 0.887 | 1.3e-92 | |
| TAIR|locus:2143543 | 503 | JKD "AT5G03150" [Arabidopsis t | 0.283 | 0.361 | 0.795 | 4.8e-92 | |
| TAIR|locus:2205672 | 455 | IDD7 "AT1G55110" [Arabidopsis | 0.311 | 0.439 | 0.721 | 1.1e-90 | |
| TAIR|locus:2078262 | 446 | AT3G45260 "AT3G45260" [Arabido | 0.317 | 0.457 | 0.704 | 1.1e-90 | |
| TAIR|locus:2167608 | 466 | NUC "AT5G44160" [Arabidopsis t | 0.314 | 0.433 | 0.716 | 1.1e-90 | |
| TAIR|locus:2101739 | 452 | IDD2 "AT3G50700" [Arabidopsis | 0.262 | 0.373 | 0.828 | 7.7e-90 |
| TAIR|locus:2051698 IDD5 "AT2G02070" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 941 (336.3 bits), Expect = 2.2e-115, Sum P(3) = 2.2e-115
Identities = 192/277 (69%), Positives = 212/277 (76%)
Query: 1 MNMSASSSAPFFEIRED-QNQMKQQHXXXXX--------XXXXXXXXXXXQKKKRNQPGT 51
M S+SS+A FF +R+D Q+ + + QKKKRNQP T
Sbjct: 1 MAASSSSAASFFGVRQDDQSHLLPPNSSAAAPPPPPPHHQAPLPPLEAPPQKKKRNQPRT 60
Query: 52 PNPDAEVIALSPKTLMATNRFICEVCNKGFQREQNLQLHRRGHNLPWKLKQKTTKEVKRK 111
PN DAEVIALSPKTLMATNRFICEVCNKGFQREQNLQLHRRGHNLPWKLKQK+TKEVKRK
Sbjct: 61 PNSDAEVIALSPKTLMATNRFICEVCNKGFQREQNLQLHRRGHNLPWKLKQKSTKEVKRK 120
Query: 112 VYLCPEPTCVHHDPSRALGDLTGIKKHYSRKHGEKKWKCEKCSKRYAVQSDWKAHSKTCG 171
VYLCPEP+CVHHDPSRALGDLTGIKKHY RKHGEKKWKC+KCSKRYAVQSDWKAHSKTCG
Sbjct: 121 VYLCPEPSCVHHDPSRALGDLTGIKKHYYRKHGEKKWKCDKCSKRYAVQSDWKAHSKTCG 180
Query: 172 TREYRCDCGTLFSRRDSFITHRAFCDALAQESARHQPSLSAIGSHLYA---STNN----- 223
T+EYRCDCGTLFSRRDSFITHRAFCDALAQESARH SL+++ SH + +TNN
Sbjct: 181 TKEYRCDCGTLFSRRDSFITHRAFCDALAQESARHPTSLTSLPSHHFPYGQNTNNSNNNA 240
Query: 224 --MALGLSQVG-PQLSSIKDHHQTNQSGDILCLGGSG 257
M LGLS +G PQ ++ DH Q GD+L LG G
Sbjct: 241 SSMILGLSHMGAPQ--NL-DH----QPGDVLRLGSGG 270
|
|
| TAIR|locus:2051688 IDD4 "indeterminate(ID)-domain 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2173624 IDD1 "AT5G66730" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2024193 MGP "AT1G03840" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2204503 AT1G14580 "AT1G14580" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2143543 JKD "AT5G03150" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2205672 IDD7 "AT1G55110" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2078262 AT3G45260 "AT3G45260" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2167608 NUC "AT5G44160" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2101739 IDD2 "AT3G50700" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 643 | |||
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 99.9 | |
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 99.89 | |
| KOG1074 | 958 | consensus Transcriptional repressor SALM [Transcri | 99.79 | |
| KOG3608 | 467 | consensus Zn finger proteins [General function pre | 99.69 | |
| KOG3608 | 467 | consensus Zn finger proteins [General function pre | 99.65 | |
| KOG3576 | 267 | consensus Ovo and related transcription factors [T | 99.65 | |
| KOG1074 | 958 | consensus Transcriptional repressor SALM [Transcri | 99.56 | |
| KOG3576 | 267 | consensus Ovo and related transcription factors [T | 99.5 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 99.41 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 99.4 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 99.06 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 98.93 | |
| PHA00733 | 128 | hypothetical protein | 98.79 | |
| PHA00733 | 128 | hypothetical protein | 98.75 | |
| KOG3993 | 500 | consensus Transcription factor (contains Zn finger | 98.64 | |
| KOG3993 | 500 | consensus Transcription factor (contains Zn finger | 98.36 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 98.33 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 98.21 | |
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 98.07 | |
| COG5189 | 423 | SFP1 Putative transcriptional repressor regulating | 97.87 | |
| COG5189 | 423 | SFP1 Putative transcriptional repressor regulating | 97.68 | |
| PHA00732 | 79 | hypothetical protein | 97.46 | |
| PHA00616 | 44 | hypothetical protein | 97.41 | |
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 97.28 | |
| PHA00732 | 79 | hypothetical protein | 97.17 | |
| PHA00616 | 44 | hypothetical protein | 97.13 | |
| KOG2231 | 669 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.02 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 96.86 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 96.77 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 96.75 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 96.73 | |
| COG5048 | 467 | FOG: Zn-finger [General function prediction only] | 96.47 | |
| COG5048 | 467 | FOG: Zn-finger [General function prediction only] | 96.45 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 96.35 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 96.23 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 96.11 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 95.91 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 95.9 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 95.88 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 95.59 | |
| KOG1146 | 1406 | consensus Homeobox protein [General function predi | 95.13 | |
| KOG2231 | 669 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.67 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 94.55 | |
| PF09237 | 54 | GAGA: GAGA factor; InterPro: IPR015318 Zinc finger | 94.43 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 94.42 | |
| PRK04860 | 160 | hypothetical protein; Provisional | 94.24 | |
| PRK04860 | 160 | hypothetical protein; Provisional | 93.17 | |
| KOG1146 | 1406 | consensus Homeobox protein [General function predi | 93.16 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 93.09 | |
| KOG2482 | 423 | consensus Predicted C2H2-type Zn-finger protein [T | 92.74 | |
| PF09237 | 54 | GAGA: GAGA factor; InterPro: IPR015318 Zinc finger | 92.49 | |
| KOG4173 | 253 | consensus Alpha-SNAP protein [Intracellular traffi | 92.32 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 91.81 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 91.59 | |
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 91.27 | |
| KOG4124 | 442 | consensus Putative transcriptional repressor regul | 91.17 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 90.41 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 90.3 | |
| KOG2482 | 423 | consensus Predicted C2H2-type Zn-finger protein [T | 88.32 | |
| KOG2893 | 341 | consensus Zn finger protein [General function pred | 88.26 | |
| KOG1280 | 381 | consensus Uncharacterized conserved protein contai | 86.06 | |
| KOG2785 | 390 | consensus C2H2-type Zn-finger protein [General fun | 84.97 | |
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 84.13 | |
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 83.92 | |
| KOG2785 | 390 | consensus C2H2-type Zn-finger protein [General fun | 83.21 | |
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 81.74 | |
| KOG2893 | 341 | consensus Zn finger protein [General function pred | 80.26 | |
| TIGR00622 | 112 | ssl1 transcription factor ssl1. This family is bas | 80.25 |
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
Probab=99.90 E-value=1.4e-24 Score=218.79 Aligned_cols=135 Identities=22% Similarity=0.411 Sum_probs=126.3
Q ss_pred CCCCCCCCCCCCCCCChhhhhcCccccCC---CCccccCcccccccCchhHHhHhhhcCCCccccccccccccCceeeCC
Q 006491 40 PPQKKKRNQPGTPNPDAEVIALSPKTLMA---TNRFICEVCNKGFQREQNLQLHRRGHNLPWKLKQKTTKEVKRKVYLCP 116 (643)
Q Consensus 40 ~p~~~~c~~cg~~~~~~~~l~~h~k~h~~---~kpy~C~~CgK~F~~~~~L~~H~r~H~~~~~~~~~~~~~~~~k~y~C~ 116 (643)
...+++|.+|++.+.....|.+|+.+|.. .+.+.|++|+|.|.+...|+.|+|+|+ -+++|.
T Consensus 127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~---------------l~c~C~ 191 (279)
T KOG2462|consen 127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT---------------LPCECG 191 (279)
T ss_pred cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC---------------CCcccc
Confidence 55678999999999999999999999865 678999999999999999999999994 578898
Q ss_pred CCCccCCCCCCcccChhhHHhHhhhccCCcccccccccccccchhhhhhcccc-cCCceeecC-CCCCcCChHHHHHHHH
Q 006491 117 EPTCVHHDPSRALGDLTGIKKHYSRKHGEKKWKCEKCSKRYAVQSDWKAHSKT-CGTREYRCD-CGTLFSRRDSFITHRA 194 (643)
Q Consensus 117 ~C~C~~~~~~k~F~~~s~L~~H~r~H~geKpfkC~~CgKsF~~ks~L~~H~rt-hgeKpy~C~-CgK~F~~ks~L~~H~~ 194 (643)
+| +|.|.....|+-|+|+|+|||||.|..|+|.|..+++|+.||++ .+.|+|.|. |+|.|.+++.|.+|..
T Consensus 192 iC-------GKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~E 264 (279)
T KOG2462|consen 192 IC-------GKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSE 264 (279)
T ss_pred cc-------cccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhh
Confidence 88 99999999999999999999999999999999999999999999 688999999 9999999999999987
Q ss_pred Hh
Q 006491 195 FC 196 (643)
Q Consensus 195 ~H 196 (643)
..
T Consensus 265 S~ 266 (279)
T KOG2462|consen 265 SA 266 (279)
T ss_pred hc
Confidence 54
|
|
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG1074 consensus Transcriptional repressor SALM [Transcription] | Back alignment and domain information |
|---|
| >KOG3608 consensus Zn finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3608 consensus Zn finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3576 consensus Ovo and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >KOG1074 consensus Transcriptional repressor SALM [Transcription] | Back alignment and domain information |
|---|
| >KOG3576 consensus Ovo and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] | Back alignment and domain information |
|---|
| >KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5048 FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5048 FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1146 consensus Homeobox protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >PRK04860 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04860 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1146 consensus Homeobox protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >KOG4124 consensus Putative transcriptional repressor regulating G2/M transition [Transcription; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG2893 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
| >KOG2893 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00622 ssl1 transcription factor ssl1 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 643 | ||||
| 2i13_A | 190 | Aart, A Six Finger Zinc Finger Designed To Recogniz | 4e-08 | ||
| 1mey_C | 87 | Crystal Structure Of A Designed Zinc Finger Protein | 1e-04 |
| >pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 | Back alignment and structure |
|
| >pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 643 | |||
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 1e-09 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 2e-05 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 2e-08 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 1e-06 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 8e-07 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 2e-06 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 3e-06 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 7e-06 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 3e-06 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 1e-05 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 6e-04 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 5e-06 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 1e-05 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 2e-04 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 1e-05 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 1e-04 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 2e-05 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 2e-04 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 2e-05 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 8e-04 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 3e-05 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 3e-05 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 8e-05 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 1e-04 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 1e-04 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 2e-04 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 4e-04 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 6e-04 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 5e-04 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 7e-04 |
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
Score = 55.6 bits (135), Expect = 1e-09
Identities = 35/128 (27%), Positives = 56/128 (43%), Gaps = 26/128 (20%)
Query: 72 FICE--VCNKGFQREQNLQLHRRGHNLPWKLKQKTTKEVKRKVYLCPEPTCVHHDPSRAL 129
F+C CNK + + +LQ+H R H T E K Y C C R
Sbjct: 7 FMCAYPGCNKRYFKLSHLQMHSRKH----------TGE---KPYQCDFKDC-----ERRF 48
Query: 130 GDLTGIKKHYSRKH-GEKKWKCEKCSKRYAVQSDWKAHSKT-CGTREYRC---DCGTLFS 184
+K+H R+H G K ++C+ C ++++ K H++T G + + C C F+
Sbjct: 49 SRSDQLKRH-QRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFA 107
Query: 185 RRDSFITH 192
R D + H
Sbjct: 108 RSDELVRH 115
|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 643 | |||
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 99.96 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 99.94 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 99.91 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 99.88 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 99.88 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 99.85 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 99.83 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 99.82 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 99.81 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 99.8 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 99.8 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 99.79 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 99.78 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 99.77 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 99.77 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 99.74 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 99.66 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 99.65 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 99.65 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 99.64 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 99.64 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 99.64 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 99.63 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 99.61 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 99.61 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 99.6 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 99.6 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 99.59 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 99.59 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 99.57 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 99.57 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 99.56 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 99.53 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 99.5 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 99.5 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 99.49 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 99.49 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 99.48 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 99.42 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 99.42 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 99.41 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 99.4 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 99.39 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 99.38 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 99.37 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 99.36 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 99.35 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 99.35 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 99.34 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 99.32 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 99.31 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 99.31 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 99.29 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 99.28 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 99.27 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 99.27 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 99.26 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 99.23 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 99.23 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 99.21 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 99.2 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 99.19 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 99.18 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 99.17 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 99.16 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 99.15 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 99.13 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 99.12 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 99.11 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 99.11 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 99.09 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 99.05 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 99.05 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 99.01 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 99.0 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 98.99 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 98.99 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 98.99 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 98.95 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 98.95 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 98.93 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 98.89 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.86 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 98.86 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.84 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 98.84 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 98.84 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.84 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.83 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.83 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.83 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.83 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.83 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 98.83 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 98.82 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.82 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.82 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.82 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.82 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.81 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.81 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.81 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.81 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 98.81 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.81 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.81 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.81 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.81 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.81 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.81 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.81 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.81 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.8 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.8 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.8 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.8 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.79 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.79 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.79 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.79 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 98.79 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 98.79 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 98.78 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.78 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 98.77 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 98.77 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 98.77 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.77 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.77 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 98.77 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 98.77 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.76 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 98.76 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.76 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.73 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.73 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.72 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 98.72 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 98.72 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.72 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 98.71 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 98.71 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 98.71 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.7 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 98.7 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 98.7 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.7 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.7 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.7 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.7 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.69 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.69 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.69 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.69 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.69 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.69 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.69 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.69 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.68 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.68 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 98.68 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 98.68 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.68 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 98.68 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.68 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.67 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.67 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.67 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.67 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.67 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.67 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.67 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.67 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.67 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.67 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.67 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.67 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 98.67 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.67 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 98.66 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.66 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 98.66 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.66 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.66 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.66 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.66 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.66 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.66 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.66 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.66 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.66 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 98.66 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.65 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.65 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.65 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.65 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.65 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.65 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.65 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.65 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.65 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.65 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.65 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.65 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.65 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.64 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.64 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.64 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.64 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 98.64 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.64 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.64 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.63 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.63 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.63 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 98.63 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.62 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 98.62 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 98.62 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.62 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 98.61 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.61 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.61 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.61 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.6 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.6 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.6 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.59 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.59 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.59 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 98.58 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 98.58 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 98.58 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 98.58 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 98.57 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.56 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.56 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.55 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.54 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.54 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.54 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.54 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.54 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.54 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.53 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.53 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.53 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.53 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.53 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.53 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.52 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.52 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.52 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 98.52 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.51 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.51 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.51 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 98.5 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.5 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.5 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 98.49 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.49 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 98.48 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.47 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.47 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.47 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 98.47 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.46 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.46 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 98.46 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 98.46 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 98.45 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.45 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.44 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.44 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 98.43 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 98.42 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 98.42 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.41 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 98.41 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.41 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 98.4 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.39 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 98.39 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.39 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 98.37 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.36 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 98.34 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 98.34 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 98.34 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.33 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 98.29 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 98.21 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 98.2 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 98.14 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 98.13 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.06 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 97.98 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 97.97 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.96 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 97.95 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 97.94 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 97.84 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.83 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.78 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 97.77 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 97.77 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.74 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 97.74 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.74 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.7 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.7 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 97.7 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 97.67 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.67 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.64 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 97.63 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 97.63 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.62 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.61 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 97.6 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.58 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 97.56 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 97.56 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.55 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.54 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 97.54 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 97.52 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 97.5 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 97.48 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 97.48 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 97.46 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 97.44 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.41 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 97.4 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 97.39 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 97.38 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.37 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.36 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.35 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 97.31 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 97.31 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 97.3 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 96.39 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.27 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 96.37 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 97.26 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 97.26 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 97.25 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 97.24 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 96.3 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 96.26 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 97.14 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 97.11 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 96.17 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 97.07 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 97.07 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 97.07 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 97.03 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 97.02 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 96.99 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 96.99 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 96.97 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 96.96 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 96.94 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 96.94 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 96.91 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 95.81 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 96.66 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 96.63 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 96.62 | |
| 1zw8_A | 64 | Zinc-responsive transcriptional regulator ZAP1; in | 96.22 | |
| 1zw8_A | 64 | Zinc-responsive transcriptional regulator ZAP1; in | 96.15 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 95.91 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 95.7 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 95.17 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 94.38 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 94.16 | |
| 2e72_A | 49 | POGO transposable element with ZNF domain; zinc fi | 93.15 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 92.93 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 92.03 | |
| 2e72_A | 49 | POGO transposable element with ZNF domain; zinc fi | 90.98 | |
| 2yuc_A | 76 | TNF receptor-associated factor 4; ZF-TRAF, cystein | 81.37 | |
| 2yuc_A | 76 | TNF receptor-associated factor 4; ZF-TRAF, cystein | 80.81 |
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
Probab=99.96 E-value=1.9e-29 Score=244.26 Aligned_cols=171 Identities=24% Similarity=0.503 Sum_probs=144.2
Q ss_pred CCCCCCCCCCCCCCCChhhhhcCccccCCCCccccCcccccccCchhHHhHhhhcCCCccccccccccccCceeeCCCCC
Q 006491 40 PPQKKKRNQPGTPNPDAEVIALSPKTLMATNRFICEVCNKGFQREQNLQLHRRGHNLPWKLKQKTTKEVKRKVYLCPEPT 119 (643)
Q Consensus 40 ~p~~~~c~~cg~~~~~~~~l~~h~k~h~~~kpy~C~~CgK~F~~~~~L~~H~r~H~~~~~~~~~~~~~~~~k~y~C~~C~ 119 (643)
...++.|..|++.|.....|..|.+.|.++++|+|++|++.|.....|..|++.|+ ++++|.|++|
T Consensus 18 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~-------------~~~~~~C~~C- 83 (190)
T 2i13_A 18 GEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHT-------------GEKPYKCPEC- 83 (190)
T ss_dssp -------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHH-------------CCCCEECTTT-
T ss_pred CCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcC-------------CCCCccCccc-
Confidence 34568999999999999999999999999999999999999999999999999985 7889999998
Q ss_pred ccCCCCCCcccChhhHHhHhhhccCCcccccccccccccchhhhhhcccc-cCCceeecC-CCCCcCChHHHHHHHHHhh
Q 006491 120 CVHHDPSRALGDLTGIKKHYSRKHGEKKWKCEKCSKRYAVQSDWKAHSKT-CGTREYRCD-CGTLFSRRDSFITHRAFCD 197 (643)
Q Consensus 120 C~~~~~~k~F~~~s~L~~H~r~H~geKpfkC~~CgKsF~~ks~L~~H~rt-hgeKpy~C~-CgK~F~~ks~L~~H~~~Hh 197 (643)
++.|.....|..|+++|+++++|.|++|++.|.....|..|+++ +++++|.|+ |++.|..+..|.+|+++|
T Consensus 84 ------~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H- 156 (190)
T 2i13_A 84 ------GKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTH- 156 (190)
T ss_dssp ------CCEESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHH-
T ss_pred ------CCccCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhc-
Confidence 99999999999999999999999999999999999999999999 899999999 999999999999999999
Q ss_pred hhhhhhhhcCCCccccCCCCccCCccccccccccchhhhhhhhccCCCCcc
Q 006491 198 ALAQESARHQPSLSAIGSHLYASTNNMALGLSQVGPQLSSIKDHHQTNQSG 248 (643)
Q Consensus 198 ~~~~~~~~~~~~~~~~~~k~y~C~~~C~~~fs~~s~L~~H~k~hh~~~~p~ 248 (643)
.++++|.|+. |++.|.....|..|+++| .+++||
T Consensus 157 ---------------~~~~~~~C~~-C~~~f~~~~~L~~H~~~H-~~~k~~ 190 (190)
T 2i13_A 157 ---------------TGEKPYKCPE-CGKSFSRRDALNVHQRTH-TGKKTS 190 (190)
T ss_dssp ---------------HCCCCEECTT-TCCEESSHHHHHHHHTTC-------
T ss_pred ---------------CCCCCeECCC-CCCccCCHHHHHHHHHhc-CCCCCC
Confidence 5778999999 999999999999999987 445543
|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 643 | ||||
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 0.003 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 0.003 |
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: Classic zinc finger, C2H2 domain: Zinc finger protein 297b species: Human (Homo sapiens) [TaxId: 9606]
Score = 34.3 bits (78), Expect = 0.003
Identities = 10/51 (19%), Positives = 17/51 (33%), Gaps = 3/51 (5%)
Query: 145 EKKWKCEKCSKRYAVQSDWKAHSKTCGTREYRC--DCGTLFSRRDSFITHR 193
+K + C+ C K + +S H CG F + + H
Sbjct: 1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHM 50
|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 643 | |||
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 99.33 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 99.25 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 98.7 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 98.66 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 98.61 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 98.61 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 98.59 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 98.57 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 98.5 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 98.49 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 98.45 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 98.44 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 98.42 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 98.41 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.38 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 98.37 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 98.36 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 98.26 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 98.23 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 98.2 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 98.17 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 98.15 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 98.11 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 98.1 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 98.01 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 97.96 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 97.94 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 97.94 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 97.9 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 97.85 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 97.84 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 97.79 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 97.78 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 97.75 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 97.68 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 97.65 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 97.62 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 97.61 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 97.6 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 97.54 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 97.42 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 97.42 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 97.4 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 97.35 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 96.99 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 96.94 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 96.87 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 96.74 | |
| d2csha2 | 44 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 96.64 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 96.52 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 96.52 | |
| d2j7ja2 | 29 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 96.45 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 96.13 | |
| d2dmda1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 96.09 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 96.01 | |
| d2dmda3 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 95.95 | |
| d1znfa_ | 26 | XFIN, third domain {Xenopus laevis [TaxId: 8355]} | 95.93 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 95.87 | |
| d1znfa_ | 26 | XFIN, third domain {Xenopus laevis [TaxId: 8355]} | 95.79 | |
| d2j7ja2 | 29 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 95.47 | |
| d2dmda3 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 95.42 | |
| d2dlqa4 | 27 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 95.21 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 95.13 | |
| d1bhia_ | 38 | Transactivation domain of cre-bp1/atf-2 {Human (Ho | 95.11 | |
| d2dmda1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 95.11 | |
| d2csha2 | 44 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 94.98 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 94.87 | |
| d2dlqa4 | 27 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 94.83 | |
| d1tf3a2 | 30 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 94.75 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 94.68 | |
| d1njqa_ | 37 | SUPERMAN zinc finger domain {Thale cress (Arabidop | 94.61 | |
| d1x5wa2 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 94.32 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 94.15 | |
| d2glia4 | 31 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 94.11 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 94.1 | |
| d1x5wa2 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 94.07 | |
| d2dlqa2 | 28 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 93.69 | |
| d2dlqa3 | 30 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 93.61 | |
| d2adra2 | 31 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 93.43 | |
| d2glia4 | 31 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 93.43 | |
| d2adra2 | 31 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 92.64 | |
| d2dlqa1 | 26 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 92.31 | |
| d1bhia_ | 38 | Transactivation domain of cre-bp1/atf-2 {Human (Ho | 92.07 | |
| d2dlqa2 | 28 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 92.01 | |
| d2glia2 | 33 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 91.86 | |
| d2dlqa3 | 30 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 91.61 | |
| d1tf3a2 | 30 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 91.56 | |
| d2dlqa1 | 26 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 91.44 | |
| d1x6ha1 | 37 | Transcriptional repressor CTCF {Human (Homo sapien | 91.1 | |
| d1njqa_ | 37 | SUPERMAN zinc finger domain {Thale cress (Arabidop | 90.69 | |
| d2drpa2 | 26 | Tramtrack protein (two zinc-finger peptide) {Droso | 90.17 | |
| d2drpa2 | 26 | Tramtrack protein (two zinc-finger peptide) {Droso | 89.02 | |
| d2eppa1 | 53 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 89.01 | |
| d2j7ja1 | 28 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 88.51 | |
| d1x5wa1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 88.24 | |
| d2ct1a1 | 28 | Transcriptional repressor CTCF {Human (Homo sapien | 87.4 | |
| d2eppa1 | 53 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 86.09 | |
| d1x5wa1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 85.33 | |
| d1x6ha1 | 37 | Transcriptional repressor CTCF {Human (Homo sapien | 82.35 | |
| d2ct1a1 | 28 | Transcriptional repressor CTCF {Human (Homo sapien | 81.47 | |
| d1tf3a1 | 31 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 80.78 | |
| d2glia2 | 33 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 80.72 |
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: Classic zinc finger, C2H2 domain: Zinc finger protein 297b species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.33 E-value=1.5e-13 Score=105.23 Aligned_cols=51 Identities=27% Similarity=0.683 Sum_probs=25.2
Q ss_pred Ccccccccccccccchhhhhhcccc-cCCceeecC-CCCCcCChHHHHHHHHHh
Q 006491 145 EKKWKCEKCSKRYAVQSDWKAHSKT-CGTREYRCD-CGTLFSRRDSFITHRAFC 196 (643)
Q Consensus 145 eKpfkC~~CgKsF~~ks~L~~H~rt-hgeKpy~C~-CgK~F~~ks~L~~H~~~H 196 (643)
||||+|+ |+|.|..+..|..|+++ +++|||.|. |++.|..++.|.+|+++|
T Consensus 1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H 53 (53)
T d2csha1 1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH 53 (53)
T ss_dssp CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence 3445552 55555555555555444 444555554 555555555555555443
|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|