BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 006529
(641 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3PFE|A Chain A, Crystal Structure Of A M20a Metallo Peptidase (Dape,
Lpg0809) From Legionella Pneumophila Subsp. Pneumophila
Str. Philadelphia 1 At 1.50 A Resolution
Length = 472
Score = 31.6 bits (70), Expect = 1.3, Method: Compositional matrix adjust.
Identities = 20/70 (28%), Positives = 30/70 (42%)
Query: 14 IVTFVVLLLIHGSHSFYLPGVAPQDFVKGDELYVKVNKLTSTKTQLPYSYYSIPYCRPKK 73
+ V L+ G HS G+ F +L ++ + + +LP Y IP R K+
Sbjct: 211 VGKLTVELINEGVHSGSASGIVADSFRVARQLISRIEDENTGEIKLPQLYCDIPDERIKQ 270
Query: 74 IVDSAENLGE 83
AE LGE
Sbjct: 271 AKQCAEILGE 280
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.327 0.142 0.448
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 17,387,322
Number of Sequences: 62578
Number of extensions: 685077
Number of successful extensions: 1485
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1483
Number of HSP's gapped (non-prelim): 2
length of query: 641
length of database: 14,973,337
effective HSP length: 105
effective length of query: 536
effective length of database: 8,402,647
effective search space: 4503818792
effective search space used: 4503818792
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 55 (25.8 bits)