BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 006529
         (641 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3PFE|A Chain A, Crystal Structure Of A M20a Metallo Peptidase (Dape,
           Lpg0809) From Legionella Pneumophila Subsp. Pneumophila
           Str. Philadelphia 1 At 1.50 A Resolution
          Length = 472

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 30/70 (42%)

Query: 14  IVTFVVLLLIHGSHSFYLPGVAPQDFVKGDELYVKVNKLTSTKTQLPYSYYSIPYCRPKK 73
           +    V L+  G HS    G+    F    +L  ++    + + +LP  Y  IP  R K+
Sbjct: 211 VGKLTVELINEGVHSGSASGIVADSFRVARQLISRIEDENTGEIKLPQLYCDIPDERIKQ 270

Query: 74  IVDSAENLGE 83
               AE LGE
Sbjct: 271 AKQCAEILGE 280


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.142    0.448 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 17,387,322
Number of Sequences: 62578
Number of extensions: 685077
Number of successful extensions: 1485
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1483
Number of HSP's gapped (non-prelim): 2
length of query: 641
length of database: 14,973,337
effective HSP length: 105
effective length of query: 536
effective length of database: 8,402,647
effective search space: 4503818792
effective search space used: 4503818792
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 55 (25.8 bits)