Citrus Sinensis ID: 006569


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640
MAELLVGSEIHGFHTLKDLDVANMMEEAKTRWLRPNEIHAILCNSKYFSINAKPVNLPKSGTVVLFDRKMLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYRETHEGTPATPPNSHSSSISDQSAPLLLSEEFNSGAGHAYSAGGKELQAPNESLTVQNHEMRLHELNTLEWDDLVVTNDSNDSTEPRGDKFSHFDQQNHTAIKGAASNGSFFPSHDSYAEVSSGGCLTSLSQPIDRSNNTQFNNLDGVYSELMGTQSSVSSQRNEFGEVCTGDSLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVLEPSISSGHHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKSKWEEFQVQMRLAHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLPEAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGRYESSSYHIYQISMQLVRLSLYALYK
ccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHcccccccccccccccccccEEEEcHHHHHcccccccccEEcccccccHHHHHHHccccEEEEEEEEEccccccccccEEEEccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEECccccccccccEEEEEEccccccccccccccEEEEEccCEEEEEEECccEEEEEccccccCEEEEEEEEcccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHHcHHHHHHHHHHHccccccccccccccc
****LVGSEIHGFHTLKDLDVANMMEEAKTRWLRPNEIHAILCNSKYFSINAKPVNLPKSGTVVLFDRKMLRNFRKDGHNWKKKK**********HLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYR**************************************************************************************************************************************************************************************QSQDS**KW*N****************************PEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYR****************WEEFQVQMRLAHLLFSSFKGLNILS*********************SNSWAYLFKSVGDKRTSLPEAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGRYESSSYHIYQISMQLVRLSLYALY*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAELLVGSEIHGFHTLKDLDVANMMEEAKTRWLRPNEIHAILCNSKYFSINAKPVNLPKSGTVVLFDRKMLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYRETHEGTPATPPNSHSSSISDQSAPLLLSEEFNSGAGHAYSAGGKELQAPNESLTVQNHEMRLHELNTLEWDDLVVTNDSNDSTEPRGDKFSHFDQQNHTAIKGAASNGSFFPSHDSYAEVSSGGCLTSLSQPIDRSNNTQFNNLDGVYSELMGTQSSVSSQRNEFGEVCTGDSLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVLEPSISSGHHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKSKWEEFQVQMRLAHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLPEAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGRYESSSYHIYQISMQLVRLSLYALYK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calmodulin-binding transcription activator 5 Regulates transcriptional activity in response to calcium signals. Binds to the consensus sequence 5'-[ACG]CGCG[GTC]-3'. Activates the expression of the V-PPase proton pump in pollen.probableO23463

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EHR, chain A
Confidence level:very confident
Coverage over the Query: 516-620
View the alignment between query and template
View the model in PyMOL
Template: 2CXK, chain A
Confidence level:very confident
Coverage over the Query: 363-454
View the alignment between query and template
View the model in PyMOL
Template: 3EU9, chain A
Confidence level:confident
Coverage over the Query: 401-626
View the alignment between query and template
View the model in PyMOL