Citrus Sinensis ID: 006573


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640
MASHQRNRGSGFKVSVCGQEEIEQLSRDGSHYSLSTGVLPSLGARSNRRVKLRRFIVSPYDRRYRVWETYLVLLVIYTAWASPFEFGFLRKPQRPLSVIDNVVNGFFAVDIILTFFVAYLDKATYLLVDCPKQIAWKYASSWLVFDVISTIPSELAQKISPKPLQSYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRCCKLIFVTLFAVHCAGCFYYLLAARYHNPERTWIGASLGQNFLEKSLWIRYVTSMYWSITTLTTVGYGDLHPVNTREMVFDILFMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSFAQRNQLPIRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLMDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVLKNGVEQVVGEAKTGEICGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHLKDLKDPIMEGVLLETENMLARGRMDLPLSLCFAALRGDDLLLHQLLKRGLDPNESDNNGRTALVCLTHFNSEFFSIPISCNNVIKFLLFNLFYFKQHIAASKGSENCVLLLLDYEADPNSIGMLVTKYIIRFFGFVH
ccccccccccccCEECcccHHHHHHcccccccccccccccccccccccccccccEEEccccHHHHHHHHHHHHHHHHHHHHccEEEEECccccccCEEHHHHHHHHHHHHHHHHccEEEEEcccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHHHHccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcCEECcccccEEEEccccccCEEEEEEcEEEEEEEccccEEEEEEEccccEEEcccccccccCEEEEEEcccEEEEEEcHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHccccccccHHHHHcccHHHHHHHHHccccccccccHHHHHHHHHHcccc
*************************************VLPSLGARSNRRVKLRRFIVSPYDRRYRVWETYLVLLVIYTAWASPFEFGFLRKPQRPLSVIDNVVNGFFAVDIILTFFVAYLDKATYLLVDCPKQIAWKYASSWLVFDVISTIPSELAQKISPKPLQSYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRCCKLIFVTLFAVHCAGCFYYLLAARYHNPERTWIGASLGQNFLEKSLWIRYVTSMYWSITTLTTVGYGDLHPVNTREMVFDILFMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSFAQRNQLPIRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLMDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVLKNGVEQVVGEAKTGEICGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHLKDLKDPIMEGVLLETENMLARGRMDLPLSLCFAALRGDDLLLHQLLKRGL********GRTALVCLTHFNSEFFSIPISCNNVIKFLLFNLFYFKQHIAASKGSENCVLLLLDYEADPNSIGMLVTKYIIRFFGFVH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASHQRNRGSGFKVSVCGQEEIEQLSRDGSHYSLSTGVLPSLGARSNRRVKLRRFIVSPYDRRYRVWETYLVLLVIYTAWASPFEFGFLRKPQRPLSVIDNVVNGFFAVDIILTFFVAYLDKATYLLVDCPKQIAWKYASSWLVFDVISTIPSELAQKISPKPLQSYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRCCKLIFVTLFAVHCAGCFYYLLAARYHNPERTWIGASLGQNFLEKSLWIRYVTSMYWSITTLTTVGYGDLHPVNTREMVFDILFMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSFAQRNQLPIRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLMDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVLKNGVEQVVGEAKTGEICGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHLKDLKDPIMEGVLLETENMLARGRMDLPLSLCFAALRGDDLLLHQLLKRGLDPNESDNNGRTALVCLTHFNSEFFSIPISCNNVIKFLLFNLFYFKQHIAASKGSENCVLLLLDYEADPNSIGMLVTKYIIRFFGFVH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Potassium channel AKT1 Highly selective inward-rectifying potassium channel that mediate potassium uptake by plant roots in response to low K(+) conditions, by a calcium-, CBL-, and CIPK-dependent pathway. Involved in the stomatal regulation by monitoring the turgor pressure in guard cells. Assuming opened or closed conformations in response to the voltage difference across the membrane, the channel is activated by hyperpolarization. May interact with the cytoskeleton or with regulatory proteins.probableQ38998
Potassium channel AKT1 Highly selective inward-rectifying potassium channel that mediates potassium uptake by plant roots. Assuming opened or closed conformations in response to the voltage difference across the membrane, the channel is activated by hyperpolarization. May be a major salt-sensitive potassium channel in roots.probableQ0JKV1
Potassium channel AKT1 Highly selective inward-rectifying potassium channel that mediates potassium uptake by plant roots.probableP0C550

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 526-639
View the alignment between query and template
View the model in PyMOL
Template: 3TNP, chain B
Confidence level:very confident
Coverage over the Query: 366-497
View the alignment between query and template
View the model in PyMOL
Template: 2PTM, chain A
Confidence level:very confident
Coverage over the Query: 307-503
View the alignment between query and template
View the model in PyMOL
Template: 3BEH, chain A
Confidence level:very confident
Coverage over the Query: 61-118,131-225,243-315,338-341,373-376
View the alignment between query and template
View the model in PyMOL