BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 006621
         (638 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3I6S|A Chain A, Crystal Structure Of The Plant Subtilisin-Like Protease
           Sbt3
 pdb|3I6S|B Chain B, Crystal Structure Of The Plant Subtilisin-Like Protease
           Sbt3
 pdb|3I74|A Chain A, Crystal Structure Of The Plant Subtilisin-Like Protease
           Sbt3 In Complex With A Chloromethylketone Inhibitor
 pdb|3I74|B Chain B, Crystal Structure Of The Plant Subtilisin-Like Protease
           Sbt3 In Complex With A Chloromethylketone Inhibitor
          Length = 649

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 2   WLTCLASAYRTACTIVGSITFYGPSSLRGQVTFPAFSYVTVILIVTDATLGD 53
           W+ C+AS + T  T  G++T      +RG   FPA ++V    ++ + TL D
Sbjct: 219 WILCVASGH-TDRTFAGTLTLGNGLKIRGWSLFPARAFVRDSPVIYNKTLSD 269


>pdb|1Z6H|A Chain A, Solution Structure Of Bacillus Subtilis Blap Biotinylated-
           Form
 pdb|1Z7T|A Chain A, Solution Structure Of Bacillus Subtilis Blap Apo-Form
 pdb|2B8F|A Chain A, Solution Structure Of Bacillus Subtilis Blap Apo Form
           (Energy Minimized Mean Structure)
 pdb|2B8G|A Chain A, Solution Structure Of Bacillus Subtilis Blap Biotinylated-
           Form (Energy Minimized Mean Structure)
          Length = 72

 Score = 30.4 bits (67), Expect = 3.4,   Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 26/50 (52%), Gaps = 5/50 (10%)

Query: 201 SISLAKSLTKSGTKHIQNIKRYQE-----SMKWEIPFKFLRSNYVKPVKK 245
           SI +A +L K   K    I++ QE     SMK EIP    RS  VK VKK
Sbjct: 3   SIQMAGNLWKVHVKAGDQIEKGQEVAILESMKMEIPIVADRSGIVKEVKK 52


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.136    0.416 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,782,283
Number of Sequences: 62578
Number of extensions: 612788
Number of successful extensions: 1484
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1484
Number of HSP's gapped (non-prelim): 2
length of query: 638
length of database: 14,973,337
effective HSP length: 105
effective length of query: 533
effective length of database: 8,402,647
effective search space: 4478610851
effective search space used: 4478610851
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 55 (25.8 bits)