BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 006639
         (637 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4HG6|A Chain A, Structure Of A Cellulose Synthase - Cellulose
           Translocation Intermediate
          Length = 802

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 45/85 (52%), Gaps = 7/85 (8%)

Query: 438 DEVGCLYGAT-AEDNLTGLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQK-RWATG 495
           DE G   G T  ED  T L IHS+GW+S Y   I  A +    P   A   QQ+ RWATG
Sbjct: 330 DEAGGFAGETITEDAETALEIHSRGWKSLY---IDRAMIAGLQPETFASFIQQRGRWATG 386

Query: 496 LLEILFSKRNPILATLIGKLQFRQC 520
           ++++L  K NP+    +G  Q R C
Sbjct: 387 MMQMLLLK-NPLFRRGLGIAQ-RLC 409


>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform
           Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With
           Nad, From Arabidopsis Thaliana
 pdb|3K2B|B Chain B, Crystal Structure Of Photosynthetic A4 Isoform
           Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With
           Nad, From Arabidopsis Thaliana
 pdb|3K2B|C Chain C, Crystal Structure Of Photosynthetic A4 Isoform
           Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With
           Nad, From Arabidopsis Thaliana
 pdb|3K2B|D Chain D, Crystal Structure Of Photosynthetic A4 Isoform
           Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With
           Nad, From Arabidopsis Thaliana
 pdb|3K2B|E Chain E, Crystal Structure Of Photosynthetic A4 Isoform
           Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With
           Nad, From Arabidopsis Thaliana
 pdb|3K2B|F Chain F, Crystal Structure Of Photosynthetic A4 Isoform
           Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With
           Nad, From Arabidopsis Thaliana
 pdb|3K2B|G Chain G, Crystal Structure Of Photosynthetic A4 Isoform
           Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With
           Nad, From Arabidopsis Thaliana
 pdb|3K2B|H Chain H, Crystal Structure Of Photosynthetic A4 Isoform
           Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With
           Nad, From Arabidopsis Thaliana
 pdb|3K2B|O Chain O, Crystal Structure Of Photosynthetic A4 Isoform
           Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With
           Nad, From Arabidopsis Thaliana
 pdb|3K2B|Q Chain Q, Crystal Structure Of Photosynthetic A4 Isoform
           Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With
           Nad, From Arabidopsis Thaliana
 pdb|3QV1|A Chain A, Crystal Structure Of The Binary Complex Of Photosyntetic
           A4 Glyceraldehyde 3-Phosphate Dehydrogenase (Gapdh) With
           Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|B Chain B, Crystal Structure Of The Binary Complex Of Photosyntetic
           A4 Glyceraldehyde 3-Phosphate Dehydrogenase (Gapdh) With
           Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|C Chain C, Crystal Structure Of The Binary Complex Of Photosyntetic
           A4 Glyceraldehyde 3-Phosphate Dehydrogenase (Gapdh) With
           Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|D Chain D, Crystal Structure Of The Binary Complex Of Photosyntetic
           A4 Glyceraldehyde 3-Phosphate Dehydrogenase (Gapdh) With
           Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|E Chain E, Crystal Structure Of The Binary Complex Of Photosyntetic
           A4 Glyceraldehyde 3-Phosphate Dehydrogenase (Gapdh) With
           Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|F Chain F, Crystal Structure Of The Binary Complex Of Photosyntetic
           A4 Glyceraldehyde 3-Phosphate Dehydrogenase (Gapdh) With
           Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|A Chain A, Crystal Structure Of The Binary Complex, Obtained By
           Soaking, Of Photosyntetic A4 Glyceraldehyde 3-Phosphate
           Dehydrogenase (Gapdh) With Cp12-2, Both From Arabidopsis
           Thaliana.
 pdb|3RVD|B Chain B, Crystal Structure Of The Binary Complex, Obtained By
           Soaking, Of Photosyntetic A4 Glyceraldehyde 3-Phosphate
           Dehydrogenase (Gapdh) With Cp12-2, Both From Arabidopsis
           Thaliana.
 pdb|3RVD|C Chain C, Crystal Structure Of The Binary Complex, Obtained By
           Soaking, Of Photosyntetic A4 Glyceraldehyde 3-Phosphate
           Dehydrogenase (Gapdh) With Cp12-2, Both From Arabidopsis
           Thaliana.
 pdb|3RVD|D Chain D, Crystal Structure Of The Binary Complex, Obtained By
           Soaking, Of Photosyntetic A4 Glyceraldehyde 3-Phosphate
           Dehydrogenase (Gapdh) With Cp12-2, Both From Arabidopsis
           Thaliana.
 pdb|3RVD|E Chain E, Crystal Structure Of The Binary Complex, Obtained By
           Soaking, Of Photosyntetic A4 Glyceraldehyde 3-Phosphate
           Dehydrogenase (Gapdh) With Cp12-2, Both From Arabidopsis
           Thaliana.
 pdb|3RVD|F Chain F, Crystal Structure Of The Binary Complex, Obtained By
           Soaking, Of Photosyntetic A4 Glyceraldehyde 3-Phosphate
           Dehydrogenase (Gapdh) With Cp12-2, Both From Arabidopsis
           Thaliana.
 pdb|3RVD|G Chain G, Crystal Structure Of The Binary Complex, Obtained By
           Soaking, Of Photosyntetic A4 Glyceraldehyde 3-Phosphate
           Dehydrogenase (Gapdh) With Cp12-2, Both From Arabidopsis
           Thaliana.
 pdb|3RVD|H Chain H, Crystal Structure Of The Binary Complex, Obtained By
           Soaking, Of Photosyntetic A4 Glyceraldehyde 3-Phosphate
           Dehydrogenase (Gapdh) With Cp12-2, Both From Arabidopsis
           Thaliana.
 pdb|3RVD|O Chain O, Crystal Structure Of The Binary Complex, Obtained By
           Soaking, Of Photosyntetic A4 Glyceraldehyde 3-Phosphate
           Dehydrogenase (Gapdh) With Cp12-2, Both From Arabidopsis
           Thaliana.
 pdb|3RVD|Q Chain Q, Crystal Structure Of The Binary Complex, Obtained By
           Soaking, Of Photosyntetic A4 Glyceraldehyde 3-Phosphate
           Dehydrogenase (Gapdh) With Cp12-2, Both From Arabidopsis
           Thaliana
          Length = 337

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query: 254 VYISREKRPKHPHHYKAGAMNVLTRVSGLMTNAPFMLNVDCDMYANNPEIVLQAMC 309
           V++ RE   KH    +AGA  V+    G      +++ V+ D Y+++  I+  A C
Sbjct: 102 VFVDREGAGKH---IEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASC 154


>pdb|2OZV|A Chain A, Crystal Structure Of A Predicted O-methyltransferase,
           Protein Atu636 From Agrobacterium Tumefaciens.
 pdb|2OZV|B Chain B, Crystal Structure Of A Predicted O-methyltransferase,
           Protein Atu636 From Agrobacterium Tumefaciens
          Length = 260

 Score = 29.3 bits (64), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 3/64 (4%)

Query: 408 TGGYSSNISRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNLTGLVIHSKGWRSGYC 467
           +GG  S ISR    A  +A CG  +G   G E+  ++    ED +  LV   KG R+   
Sbjct: 162 SGGQLSLISRPQSVAEIIAACGSRFG---GLEITLIHPRPGEDAVRXLVTAIKGSRARLT 218

Query: 468 LPIP 471
              P
Sbjct: 219 FRAP 222


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.138    0.439 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 18,703,427
Number of Sequences: 62578
Number of extensions: 768772
Number of successful extensions: 1322
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 1321
Number of HSP's gapped (non-prelim): 4
length of query: 637
length of database: 14,973,337
effective HSP length: 105
effective length of query: 532
effective length of database: 8,402,647
effective search space: 4470208204
effective search space used: 4470208204
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 55 (25.8 bits)