Citrus Sinensis ID: 006641

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------
MEATGAAAATAAVTSATTAAVPSGYGNVSLYVGDLEQNVNESQLYDLFSQVAQVVSVRVCRDQSKRSSLGYAYVNYSNPQDAANAKEALNFMPINGKPIRIMYSHRDPSIRKSGYGNVFIKNLDTSIDNKALCDTFAAFGTVLSCKVAIDSNGQSKGYGFVQFENEEAAQNAIKMLNGMLINDKQVYVGLFVRRQERAQQNVSPKFTNVYVNNLAETVTDEDLKKIFGHFGTITSAIVMKDSDGKSRCFGFVNFQSPDAAAAAVEKLNGTTNNDKVWYVGRAQKRAEREADLRAKFEQERISRYEKLKGANLYLKNLDDSINDEKLKELFSEFGTITSCKVMVDQHGFSKGSGFAAFSMPEEATRALNEMNGKMIGRKPLYVAVAQRKEERKARLQAQFAQIRAPGGMSPLASGIPGYHHGAPRLGPQQLYYGQGTPGLMPPQAAGYGFQQQVFPGLRPGGPNYIMPYHLQRQVHPGQRTGVRRSGNTHQMQQPQFMRNSNQGIRYLDNARNGTDQSVVSMVPVPFEVSGMPATPVETPRPVPVPISTLTSALASASPDDRTRMLGEQLYPLVENIEPVHASKVTGMLLEMDQTEVLHLIESPEALKTKVAEAMAVLQEAAARSDVNEKLGSLAVNE
ccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEccccccccccEEEEEcccHHHHHHHHHHHcccccccCEEEEEEccccccccccccccEEEccccccccHHHHHHHHHccccccEEEEEEccccccccCEEEEcccHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHcccccccEEEEccccccccHHHHHHHHcccccEEEEEEEEcccccccCEEEEECccHHHHHHHHHHHcccCCccCEEEEEcccccHHHHHHHHHHHHHHHHHHHccccccEEEEccccccccHHHHHHHHcccccEEEEEEEEccccccCEEEEEEcccHHHHHHHHHHHcccEEccEEEEEEEEEcHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHcHHHHccccccccccHHHcccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHcccccccc
************************YGNVSLYVGDLEQNVNESQLYDLFSQVAQVVSVRVCRDQSKRSSLGYAYVNYSNPQDAANAKEALNFMPINGKPIRIMYSHRDPSIRKSGYGNVFIKNLDTSIDNKALCDTFAAFGTVLSCKVAIDSNGQSKGYGFVQFENEEAAQNAIKMLNGMLINDKQVYVGLFVRRQERAQQNVSPKFTNVYVNNLAETVTDEDLKKIFGHFGTITSAIVMKDSDGKSRCFGFVNFQSPDAAAAAVEKLNGTTNNDKVWYVGRA******************ISRYEKLKGANLYLKNLDDSINDEKLKELFSEFGTITSCKVMVDQHGFSKGSGFAAFSMPEEATRALNEMNGKMIGRKPLYVAV*********************************YHH****LGPQQLYYGQGTPGLMPPQAAGYGFQQQVFPGLRPGGPNYIMPYHLQ**************************************************************************************PDDRTRMLGEQLYPLVENIEPVHASKVTGMLLEMDQTEVLHLIESPEALKTKVAEAMAV*********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEATGAAAATAAVTSATTAAVPSGYGNVSLYVGDLEQNVNESQLYDLFSQVAQVVSVRVCRDQSKRSSLGYAYVNYSNPQDAANAKEALNFMPINGKPIRIMYSHRDPSIRKSGYGNVFIKNLDTSIDNKALCDTFAAFGTVLSCKVAIDSNGQSKGYGFVQFENEEAAQNAIKMLNGMLINDKQVYVGLFVRRQERAQQNVSPKFTNVYVNNLAETVTDEDLKKIFGHFGTITSAIVMKDSDGKSRCFGFVNFQSPDAAAAAVEKLNGTTNNDKVWYVGRAQKRAEREADLRAKFEQERISRYEKLKGANLYLKNLDDSINDEKLKELFSEFGTITSCKVMVDQHGFSKGSGFAAFSMPEEATRALNEMNGKMIGRKPLYVAVAQRKEERKARLQAQFAQIRAPGGMSPLASGIPGYHHGAPRLGPQQLYYGQGTPGLMPPQAAGYGFQQQVFPGLRPGGPNYIMPYHLQRQVHPGQRTGVRRSGNTHQMQQPQFMRNSNQGIRYLDNARNGTDQSVVSMVPVPFEVSGMPATPVETPRPVPVPISTLTSALASASPDDRTRMLGEQLYPLVENIEPVHASKVTGMLLEMDQTEVLHLIESPEALKTKVAEAMAVLQEAAARSDVNEKLGSLAVNE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polyadenylate-binding protein 5 Binds the poly(A) tail of mRNA.probableQ05196
Polyadenylate-binding protein, cytoplasmic and nuclear Binds the poly(A) tail of mRNA. Appears to be an important mediator of the multiple roles of the poly(A) tail in mRNA biogenesis, stability and translation. In the nucleus, involved in both mRNA cleavage and polyadenylation. Is also required for efficient mRNA export to the cytoplasm. Acts in concert with a poly(A)-specific nuclease (PAN) to affect poly(A) tail shortening, which may occur concomitantly with either nucleocytoplasmic mRNA transport or translational initiation. In the cytoplasm, stimulates translation initiation and regulates mRNA decay through translation termination-coupled poly(A) shortening, probably mediated by PAN.probableQ74ZS6
Polyadenylate-binding protein 1-A Binds the poly(A) tail of mRNA. Appears to be an important mediator of the multiple roles of the poly(A) tail in mRNA biogenesis, stability and translation.probableQ54BM2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F02, chain A
Confidence level:very confident
Coverage over the Query: 27-198
View the alignment between query and template
View the model in PyMOL
Template: 3MD3, chain A
Confidence level:very confident
Coverage over the Query: 207-287,304-387
View the alignment between query and template
View the model in PyMOL
Template: 2YH0, chain A
Confidence level:very confident
Coverage over the Query: 206-389
View the alignment between query and template
View the model in PyMOL
Template: 1G9L, chain A
Confidence level:very confident
Coverage over the Query: 548-636
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 511-561
View the alignment between query and template
View the model in PyMOL