BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 006651
         (637 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1UB2|A Chain A, Crystal Structure Of Catalase-Peroxidase From
           Synechococcus Pcc 7942
          Length = 720

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 10/55 (18%)

Query: 284 GGNPHFVFSIDDRKEVFVANLSNSESGNSKSMDYMYSFHWRKGGQKEHEICDNES 338
           GG  H VF+  DR+ V    L+N    N   M+Y+    W+  G+  +EICD ++
Sbjct: 620 GGTKHVVFT--DREGV----LTNDFFVNLTDMNYL----WKPAGKNLYEICDRKT 664


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.132    0.391 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,732,996
Number of Sequences: 62578
Number of extensions: 609524
Number of successful extensions: 1101
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1101
Number of HSP's gapped (non-prelim): 1
length of query: 637
length of database: 14,973,337
effective HSP length: 105
effective length of query: 532
effective length of database: 8,402,647
effective search space: 4470208204
effective search space used: 4470208204
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)