BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 006651
(637 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1UB2|A Chain A, Crystal Structure Of Catalase-Peroxidase From
Synechococcus Pcc 7942
Length = 720
Score = 30.4 bits (67), Expect = 3.4, Method: Compositional matrix adjust.
Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 10/55 (18%)
Query: 284 GGNPHFVFSIDDRKEVFVANLSNSESGNSKSMDYMYSFHWRKGGQKEHEICDNES 338
GG H VF+ DR+ V L+N N M+Y+ W+ G+ +EICD ++
Sbjct: 620 GGTKHVVFT--DREGV----LTNDFFVNLTDMNYL----WKPAGKNLYEICDRKT 664
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.132 0.391
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,732,996
Number of Sequences: 62578
Number of extensions: 609524
Number of successful extensions: 1101
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1101
Number of HSP's gapped (non-prelim): 1
length of query: 637
length of database: 14,973,337
effective HSP length: 105
effective length of query: 532
effective length of database: 8,402,647
effective search space: 4470208204
effective search space used: 4470208204
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)