Citrus Sinensis ID: 006655


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630------
MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGPREPSAEEHDQNKQMGMVSQLPNDDQDMSKTQPAKRKKKVVKRWREEWADTYKWAYVDVKEGTARIFCSVCREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIADKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDYSKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGGVVAGELELNQECNMVHWSPEDFESKLQEAMKQTYQRALKAATDFGYQKESPEALVHGAVISSFLTIAQAMTDQGCV
cccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccEEEEEEEcccccEEHHHHHHHHHccccccccccccccccccHHHHHHccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccEEEEEEEEEEcccccEEEEEccEEccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccccEEccccccccccccccccccHHHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEccccEEEccccccHHHHHHHHHHHHccccHHHHHHccccEEEEcccccccccccEEEccHHcccccHHHHHHHHHcccEEEEEcccccccHHHHHHHHHcccEEEcccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccc
cccccccccccccHHHHHHHHHHHHHcEEEEcccccEEEEEccccccccccccccccccccccccccccccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHEcccccccEEHHHHHHHccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccccEHHHHHHHHHHHHHHHHHHHccccHHHcHHHHHHHHHHHHHcccccccHHHHHHHHcccEEEEEEEEEEcccccEEEEEEEEEEEEcccccEEEEEEEcccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHcEcccEEEEccccccHHHHHHHHHHHHHHHcccccHHccccHHHccccccccHHHHHHHHHHHHHHHHccccccccEEEEEEccHHHHHHHHHHHHcccEEEEEEEccEEEEccccccHHHHHHHHHHHHHHccHHHHHHHccccEEccccccccccccEEccccccccccHHHHHHHHHcccEEEEEcccccccHHHHHHHHHcccEEccccHHccccHHHcHHHHcHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEcEEccHHHHHHHHHHHHHHHcccc
mllpvgglgmnstmdDMNLIQQAQRHHLVVRElgeeidleigpgdddpsfannplmggprepsaeehdqnkqmgmvsqlpnddqdmsktqpakrKKKVVKRWREEWADTYKWAYVDVKEGTARIFCSVCREygrkhrrnpygnegsrnMQMSALEEHNNSLLHKEALRLQMASkdkiiadkPIYVKALMSKTAGSIVEAalkrdpheIEFIQSVQESLHALERVIAKNSHYVNIMERLlepermivfrvpwvddrgethvnrGFRVQFsqalgpcrgglrfhpsmnLSIAKFLGFEQTLKNalspyklggaaggsdfdpkgksdnEIMRFCQSFMNEIHrylgpdkdlpseemgvgtreMGYLFGQYRRlaghfqgsftgprifwsgsslrteatgYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAygaipvsvsdakgylvdedgfdymKISFLRDIKSQQRSLRDYSKTYArskyydeakpwnercdvafpcasqneidqsdainlvNSGCRilvegsnmpctpeAVDVLKKANVLIAPAMAAGAGGVVAGELElnqecnmvhwspedFESKLQEAMKQTYQRALKAAtdfgyqkespealvhGAVISSFLTIAQAMTDQGCV
MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGPREPSAEEHDQNKQMGMVSqlpnddqdmsktqpakrkkkvvkrwreewadtykwayvdvkegTARIFCSVCReygrkhrrnpygnegsRNMQMSALEEHNNSLLHKEALRLQMASKDKIIADKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLrdiksqqrslrdysKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGGVVAGELELNQECNMVHWSPEDFESKLQEAMKQTYQRALKAATDFGYQKESPEALVHGAVISSFLTIAQAMTDQGCV
MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGPREPSAEEHDQNKQMGMVSQLPNDDQDMSKTQPAkrkkkvvkrwreewADTYKWAYVDVKEGTARIFCSVCREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIADKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDYSKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMaagaggvvagELELNQECNMVHWSPEDFESKLQEAMKQTYQRALKAATDFGYQKESPEALVHGAVISSFLTIAQAMTDQGCV
************************RHHLVVRELG***************************************************************VVKRWREEWADTYKWAYVDVKEGTARIFCSVCREYG**************************************ASKDKIIADKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLG*****************IMRFCQSFMNEIHRYLG**********GVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDYSKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGGVVAGELELNQECNMVHWSP**************YQRALKAATDFGYQKESPEALVHGAVISSFLTIAQ********
********GMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPL**********************************************WREEWADTYKWAYVDVKEGTARIFCSVCREYGR************************NSLLHKEALRLQM*******************KTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDYSKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGGVVAGELELNQECNMVHWSPEDFESKLQEAMKQTYQRALKAATDFGYQKESPEALVHGAVISSFLTIAQAMTDQGCV
MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGP************QMGMVSQLP**********************REEWADTYKWAYVDVKEGTARIFCSVCREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIADKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDYSKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGGVVAGELELNQECNMVHWSPEDFESKLQEAMKQTYQRALKAATDFGYQKESPEALVHGAVISSFLTIAQAMTDQGCV
*LLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPL*************************NDDQDMSKTQPAKRKKKVVKRWREEWADTYKWAYVDVKEGTARIFCSVCREYGRKHRRNPYGNEGS*NMQMSALEEHNNSLLHKEALRLQMASKDKIIADKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDYSKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGGVVAGELELNQECNMVHWSPEDFESKLQEAMKQTYQRALKAATDFGYQKESPEALVHGAVISSFLTIAQAMTDQ***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGPREPSAEEHDQNKQMGMVSQLPNDDQDMSKTQPAKRKKKVVKRWREEWADTYKWAYVDVKEGTARIFCSVCREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIADKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDYSKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGGVVAGELELNQECNMVHWSPEDFESKLQEAMKQTYQRALKAATDFGYQKESPEALVHGAVISSFLTIAQAMTDQGCV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query636 2.2.26 [Sep-21-2011]
P28724449 NADP-specific glutamate d N/A no 0.696 0.986 0.456 1e-118
Q8RQP4447 NADP-specific glutamate d yes no 0.674 0.959 0.472 1e-114
P31026447 NADP-specific glutamate d yes no 0.674 0.959 0.465 1e-113
P28998523 NADP-specific glutamate d N/A no 0.671 0.816 0.461 1e-112
P95544444 NAD(P)-specific glutamate no no 0.687 0.984 0.431 1e-111
P94598444 Glutamate dehydrogenase O yes no 0.691 0.990 0.435 1e-109
Q8Z6F6447 NADP-specific glutamate d N/A no 0.685 0.975 0.442 1e-109
P43793449 NADP-specific glutamate d yes no 0.696 0.986 0.435 1e-109
P15111447 NADP-specific glutamate d yes no 0.685 0.975 0.440 1e-109
P55990448 NADP-specific glutamate d yes no 0.679 0.964 0.443 1e-108
>sp|P28724|DHE4_GIAIN NADP-specific glutamate dehydrogenase OS=Giardia intestinalis PE=2 SV=1 Back     alignment and function desciption
 Score =  426 bits (1095), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 206/451 (45%), Positives = 292/451 (64%), Gaps = 8/451 (1%)

Query: 190 SKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRV 249
           ++T   ++    +RD H  EF Q+V+E + +L+ +  +   Y+ I ER+LEPER+I+FRV
Sbjct: 3   AQTIEELIAVIKQRDGHMTEFRQAVEEVVDSLKVIFEREPKYIPIFERMLEPERVIIFRV 62

Query: 250 PWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLG 309
           PW+DD G  +VNRGFRVQ++ ALGP +GGLRFHPS+NLSI KFLGFEQ LKN+L+   +G
Sbjct: 63  PWMDDAGRINVNRGFRVQYNSALGPYKGGLRFHPSVNLSILKFLGFEQILKNSLTTLPMG 122

Query: 310 GAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRR 369
           G  GGSDFDPKGKSDNE+MRFCQSFM E+ R++G D D+P+ ++GVG RE+GYL+GQY+R
Sbjct: 123 GGKGGSDFDPKGKSDNEVMRFCQSFMTELQRHVGADTDVPAGDIGVGAREIGYLYGQYKR 182

Query: 370 LAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAM 429
           L   F G  TG  + W GS +R EATGYG V+F + +  D N  ++G   ++SGSG +A 
Sbjct: 183 LRNEFTGVLTGKNVKWGGSFIRPEATGYGAVYFLEEMCKDNNTVIRGKNVLLSGSGNVAQ 242

Query: 430 HVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRS-LRDYSKTYARSKY 488
              EKLI  GA  ++ SD+ G +VD+DGF+  K++ L  +K+++R  + ++   Y    Y
Sbjct: 243 FACEKLIQLGAKVLTFSDSNGTIVDKDGFNEEKLAHLMYLKNEKRGRVSEFKDKYPSVAY 302

Query: 489 YDEAKPW---NERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKK 545
           Y+  KPW     + D   PCA+QNE+   DA  LV  G + + EG+NMP T EAV V   
Sbjct: 303 YEGKKPWECFEGQMDCIMPCATQNEVSGDDATRLVGLGLKFVAEGANMPSTAEAVHVYHA 362

Query: 546 ANVLIAPAMAAGAGGVVAGELELNQECNMVHWSPEDFESKLQEAMKQTYQRALKAATDFG 605
             V+  PA A+ AGGV    LE++Q    + W+ E+ + KL+  M+  +      A  +G
Sbjct: 363 KGVMYGPAKASNAGGVSVSGLEMSQNSVRLQWTAEEVDQKLRGIMRGIFVACRDTAKKYG 422

Query: 606 YQKESPEALVHGAVISSFLTIAQAMTDQGCV 636
           +    P+    GA I+ FL +A +M +QGCV
Sbjct: 423 H----PKNYQMGANIAGFLKVADSMIEQGCV 449





Giardia intestinalis (taxid: 5741)
EC: 1EC: .EC: 4EC: .EC: 1EC: .EC: 4
>sp|Q8RQP4|DHE4_COREF NADP-specific glutamate dehydrogenase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=gdh PE=3 SV=2 Back     alignment and function description
>sp|P31026|DHE4_CORGL NADP-specific glutamate dehydrogenase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gdh PE=3 SV=2 Back     alignment and function description
>sp|P28998|DHE4_CHLSO NADP-specific glutamate dehydrogenase (Fragment) OS=Chlorella sorokiniana PE=2 SV=1 Back     alignment and function description
>sp|P95544|DHE4_PRERU NAD(P)-specific glutamate dehydrogenase OS=Prevotella ruminicola GN=gdhA PE=1 SV=1 Back     alignment and function description
>sp|P94598|DHE3_BACTN Glutamate dehydrogenase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gdhA PE=3 SV=2 Back     alignment and function description
>sp|Q8Z6F6|DHE4_SALTI NADP-specific glutamate dehydrogenase OS=Salmonella typhi GN=gdhA PE=3 SV=1 Back     alignment and function description
>sp|P43793|DHE4_HAEIN NADP-specific glutamate dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gdhA PE=3 SV=1 Back     alignment and function description
>sp|P15111|DHE4_SALTY NADP-specific glutamate dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gdhA PE=3 SV=2 Back     alignment and function description
>sp|P55990|DHE4_HELPY NADP-specific glutamate dehydrogenase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=gdhA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query636
449458193637 PREDICTED: NADP-specific glutamate dehyd 1.0 0.998 0.913 0.0
255549662636 glutamate dehydrogenase, putative [Ricin 1.0 1.0 0.915 0.0
225442347635 PREDICTED: NADP-specific glutamate dehyd 0.996 0.998 0.924 0.0
356526047637 PREDICTED: NADP-specific glutamate dehyd 1.0 0.998 0.885 0.0
356522684637 PREDICTED: NADP-specific glutamate dehyd 1.0 0.998 0.880 0.0
224128524621 predicted protein [Populus trichocarpa] 0.974 0.998 0.889 0.0
30695050637 glutamate dehydrogenase (NADP+) [Arabido 1.0 0.998 0.846 0.0
297847546624 hypothetical protein ARALYDRAFT_474290 [ 0.979 0.998 0.854 0.0
12321666624 NADP-specific glutatamate dehydrogenase, 0.979 0.998 0.850 0.0
147768438638 hypothetical protein VITISV_043645 [Viti 0.976 0.973 0.859 0.0
>gi|449458193|ref|XP_004146832.1| PREDICTED: NADP-specific glutamate dehydrogenase-like [Cucumis sativus] gi|449527615|ref|XP_004170805.1| PREDICTED: NADP-specific glutamate dehydrogenase-like [Cucumis sativus] Back     alignment and taxonomy information
 Score = 1204 bits (3115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/637 (91%), Positives = 622/637 (97%), Gaps = 1/637 (0%)

Query: 1   MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGP- 59
           MLLPVGGLGMN++MDDMNLIQQAQRHHLVVRELGEEIDLEIG GDDDPSFA+ P++GGP 
Sbjct: 1   MLLPVGGLGMNTSMDDMNLIQQAQRHHLVVRELGEEIDLEIGHGDDDPSFASTPIIGGPV 60

Query: 60  REPSAEEHDQNKQMGMVSQLPNDDQDMSKTQPAKRKKKVVKRWREEWADTYKWAYVDVKE 119
           REPSAE+HD++K + +VSQL NDDQDMSKTQPAKRKKKVVKRWREEWADTYKWAYVDVK+
Sbjct: 61  REPSAEDHDESKHVVLVSQLSNDDQDMSKTQPAKRKKKVVKRWREEWADTYKWAYVDVKD 120

Query: 120 GTARIFCSVCREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIA 179
           GTARIFCSVC+EYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKII 
Sbjct: 121 GTARIFCSVCKEYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIV 180

Query: 180 DKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLL 239
           DKPIYVKALMSKTAGSI+EAALKRDP+E+EFIQ+VQE++HALERVIAKNSHYVNIMERLL
Sbjct: 181 DKPIYVKALMSKTAGSIIEAALKRDPNEVEFIQAVQEAVHALERVIAKNSHYVNIMERLL 240

Query: 240 EPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTL 299
           EPERM++FRVPWVDDRGETHVNRGFRVQF+QALGPCRGGLRFHPSMNLSI KFLGFEQTL
Sbjct: 241 EPERMVLFRVPWVDDRGETHVNRGFRVQFNQALGPCRGGLRFHPSMNLSITKFLGFEQTL 300

Query: 300 KNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTRE 359
           KNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSF+NEI+RYLGPDKDLPSEEMGVGTRE
Sbjct: 301 KNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFINEIYRYLGPDKDLPSEEMGVGTRE 360

Query: 360 MGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRC 419
           MGYLFGQYRRLAGHF+GSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRC
Sbjct: 361 MGYLFGQYRRLAGHFEGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRC 420

Query: 420 VVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDY 479
            VSGSGKIAMHVLEKLIAYGA+P++VSD+KGYLVDEDGFDYMKISFLRDIK+QQRSLRDY
Sbjct: 421 AVSGSGKIAMHVLEKLIAYGALPITVSDSKGYLVDEDGFDYMKISFLRDIKAQQRSLRDY 480

Query: 480 SKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEA 539
           SKTYARSKYYDE KPWNERCDVAFPCA  NEIDQ+DAINL++SGCRIL+EGSNMPCTPEA
Sbjct: 481 SKTYARSKYYDEGKPWNERCDVAFPCAYHNEIDQADAINLISSGCRILIEGSNMPCTPEA 540

Query: 540 VDVLKKANVLIAPAMAAGAGGVVAGELELNQECNMVHWSPEDFESKLQEAMKQTYQRALK 599
           VDVL+KAN+LIAPAMAAGAGGVVAGELELN  CN++HWSPEDFESKLQEAMKQTYQRALK
Sbjct: 541 VDVLRKANILIAPAMAAGAGGVVAGELELNHACNLMHWSPEDFESKLQEAMKQTYQRALK 600

Query: 600 AATDFGYQKESPEALVHGAVISSFLTIAQAMTDQGCV 636
           AA DFGYQKESPEALVHGAVIS+FL++AQAMTDQGCV
Sbjct: 601 AAADFGYQKESPEALVHGAVISAFLSVAQAMTDQGCV 637




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255549662|ref|XP_002515882.1| glutamate dehydrogenase, putative [Ricinus communis] gi|223544787|gb|EEF46302.1| glutamate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225442347|ref|XP_002281123.1| PREDICTED: NADP-specific glutamate dehydrogenase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356526047|ref|XP_003531631.1| PREDICTED: NADP-specific glutamate dehydrogenase-like [Glycine max] Back     alignment and taxonomy information
>gi|356522684|ref|XP_003529976.1| PREDICTED: NADP-specific glutamate dehydrogenase-like [Glycine max] Back     alignment and taxonomy information
>gi|224128524|ref|XP_002329025.1| predicted protein [Populus trichocarpa] gi|222839696|gb|EEE78019.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|30695050|ref|NP_175583.2| glutamate dehydrogenase (NADP+) [Arabidopsis thaliana] gi|332194586|gb|AEE32707.1| glutamate dehydrogenase (NADP+) [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297847546|ref|XP_002891654.1| hypothetical protein ARALYDRAFT_474290 [Arabidopsis lyrata subsp. lyrata] gi|297337496|gb|EFH67913.1| hypothetical protein ARALYDRAFT_474290 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|12321666|gb|AAG50868.1|AC025294_6 NADP-specific glutatamate dehydrogenase, putative [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|147768438|emb|CAN69269.1| hypothetical protein VITISV_043645 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query636
TAIR|locus:2017542637 AT1G51720 [Arabidopsis thalian 1.0 0.998 0.810 1.2e-287
GENEDB_PFALCIPARUM|PF14_0286510 PF14_0286 "glutamate dehydroge 0.680 0.849 0.458 1.4e-112
UNIPROTKB|Q8ILF7510 PF14_0286 "Glutamate dehydroge 0.680 0.849 0.458 1.4e-112
GENEDB_PFALCIPARUM|PF14_0164470 PF14_0164 "NADP-specific gluta 0.724 0.980 0.419 2.2e-105
UNIPROTKB|Q8ILT0470 PF14_0164 "Glutamate dehydroge 0.724 0.980 0.419 2.2e-105
UNIPROTKB|Q8RQP4447 gdh "NADP-specific glutamate d 0.674 0.959 0.459 2e-104
UNIPROTKB|P31026447 gdh "NADP-specific glutamate d 0.674 0.959 0.452 1.4e-103
UNIPROTKB|P95544444 gdhA "NAD(P)-specific glutamat 0.687 0.984 0.420 1.2e-99
TIGR_CMR|GSU_1305450 GSU_1305 "Glu/Leu/Phe/Val dehy 0.683 0.966 0.445 1.7e-98
UNIPROTKB|P15111447 gdhA "NADP-specific glutamate 0.685 0.975 0.429 5.2e-97
TAIR|locus:2017542 AT1G51720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2763 (977.7 bits), Expect = 1.2e-287, P = 1.2e-287
 Identities = 516/637 (81%), Positives = 575/637 (90%)

Query:     1 MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGP- 59
             M  P GGLGMN +MDDMNLIQQAQRH LVV  LGEEIDLEIGPG+DD +FANN L+GGP 
Sbjct:     1 MFGPTGGLGMNPSMDDMNLIQQAQRHQLVVSNLGEEIDLEIGPGEDDAAFANNSLIGGPP 60

Query:    60 REPSAEEHDQNKQMGMVSQLPNDDQDMSKTQPAXXXXXXXXXXXXXXADTYKWAYVDVKE 119
             REPS  EHD+ K M +VS LP++DQD+SK  PA              ADTYKWAYVD+K+
Sbjct:    61 REPSTGEHDETKHMVLVSDLPSEDQDISKGTPAKRKKKVVKRWREEWADTYKWAYVDMKD 120

Query:   120 GTARIFCSVCREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIA 179
             GTARIFCS+CREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQ ASKDKI+ 
Sbjct:   121 GTARIFCSICREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQTASKDKIVV 180

Query:   180 DKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLL 239
             DKPIYVK +MSK+AGSIVE ALKRDP+EIEF+QSVQES+HALERVIAKNSHYVNIMERLL
Sbjct:   181 DKPIYVKTVMSKSAGSIVEGALKRDPNEIEFVQSVQESVHALERVIAKNSHYVNIMERLL 240

Query:   240 EPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTL 299
             EPERMIVFRVPW+DDRGETHVNRGFRVQF+QALGPCRGG+RFHPSMNLSIAKFLGF+QTL
Sbjct:   241 EPERMIVFRVPWIDDRGETHVNRGFRVQFNQALGPCRGGIRFHPSMNLSIAKFLGFQQTL 300

Query:   300 KNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTRE 359
             KNALSPYKLGGA+GGSDFDPKGKSDNEIMRFCQSFMNE++RY+GPDKDLPSEE+GVGTRE
Sbjct:   301 KNALSPYKLGGASGGSDFDPKGKSDNEIMRFCQSFMNEMYRYMGPDKDLPSEEVGVGTRE 360

Query:   360 MGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRC 419
             MGYLFGQYRRLAG FQGSFTGPRI+W+ SSLRTEA+GYG+V+FA+LILADMNKE+KGLRC
Sbjct:   361 MGYLFGQYRRLAGQFQGSFTGPRIYWAASSLRTEASGYGVVYFARLILADMNKEIKGLRC 420

Query:   420 VVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDY 479
             VVSG GKIAMHV+EKLIA GA PV+VSD+KGYLVD+DGFDYMK++FLRDIKSQQRSLRDY
Sbjct:   421 VVSGCGKIAMHVVEKLIACGAHPVTVSDSKGYLVDDDGFDYMKLAFLRDIKSQQRSLRDY 480

Query:   480 SKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEA 539
             SKTYAR+KY+DE KPWNERCDVAFPCASQNE+DQ+DAINLVN+GCR+LVEGSNMPCT EA
Sbjct:   481 SKTYARAKYFDELKPWNERCDVAFPCASQNEVDQADAINLVNAGCRLLVEGSNMPCTAEA 540

Query:   540 VDVLKKANVLIAPAMXXXXXXXXXXELELNQECNMVHWSPEDFESKLQEAMKQTYQRALK 599
             VDV +KANVLIAPA+          E+E+ +E N + WS EDFES+LQEA+KQTY++ALK
Sbjct:   541 VDVFRKANVLIAPAIAAGAGGVAAGEIEVLRESNSMQWSAEDFESRLQEALKQTYEKALK 600

Query:   600 AATDFGYQKESPEALVHGAVISSFLTIAQAMTDQGCV 636
             AA DFGYQKESPEAL+HGA I++FL IAQAMTDQGCV
Sbjct:   601 AANDFGYQKESPEALLHGATIAAFLNIAQAMTDQGCV 637




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006520 "cellular amino acid metabolic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA;ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0008295 "spermidine biosynthetic process" evidence=RCA
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
GENEDB_PFALCIPARUM|PF14_0286 PF14_0286 "glutamate dehydrogenase, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8ILF7 PF14_0286 "Glutamate dehydrogenase" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF14_0164 PF14_0164 "NADP-specific glutamate dehydrogenase" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8ILT0 PF14_0164 "Glutamate dehydrogenase" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
UNIPROTKB|Q8RQP4 gdh "NADP-specific glutamate dehydrogenase" [Corynebacterium efficiens YS-314 (taxid:196164)] Back     alignment and assigned GO terms
UNIPROTKB|P31026 gdh "NADP-specific glutamate dehydrogenase" [Corynebacterium glutamicum ATCC 13032 (taxid:196627)] Back     alignment and assigned GO terms
UNIPROTKB|P95544 gdhA "NAD(P)-specific glutamate dehydrogenase" [Prevotella ruminicola (taxid:839)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1305 GSU_1305 "Glu/Leu/Phe/Val dehydrogenase family protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|P15111 gdhA "NADP-specific glutamate dehydrogenase" [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 (taxid:99287)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.4.10.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.97.87.1
hypothetical protein (637 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pm.C_LG_X0783
delta-1-pyrroline-5-carboxylate synthetase (EC-2.7.2.11 1.2.1.41) (719 aa)
      0.908
eugene3.06620001
hypothetical protein (2230 aa)
     0.905
estExt_fgenesh4_pg.C_LG_XV0172
hypothetical protein (2222 aa)
     0.905
estExt_fgenesh4_pm.C_1300024
SubName- Full=Putative uncharacterized protein; (588 aa)
      0.903
estExt_fgenesh4_pg.C_LG_XVI0276
SubName- Full=Putative uncharacterized protein; (1491 aa)
      0.903
estExt_fgenesh4_pg.C_LG_VI0304
hypothetical protein (1629 aa)
      0.902
gw1.X.6258.1
hypothetical protein (497 aa)
       0.899
gw1.X.4202.1
annotation not avaliable (214 aa)
       0.899
gw1.VII.115.1
GCN5-related N-acetyltransferase (GNAT) family protein / amino acid kinase family protein (EC-2 [...] (511 aa)
       0.899
NIT2
nitrilase 2 (EC-3.5.5.1) (266 aa)
       0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query636
PRK09414445 PRK09414, PRK09414, glutamate dehydrogenase; Provi 0.0
PTZ00079454 PTZ00079, PTZ00079, NADP-specific glutamate dehydr 0.0
PRK14030445 PRK14030, PRK14030, glutamate dehydrogenase; Provi 1e-151
PRK14031444 PRK14031, PRK14031, glutamate dehydrogenase; Provi 1e-150
COG0334411 COG0334, GdhA, Glutamate dehydrogenase/leucine deh 1e-133
cd05313254 cd05313, NAD_bind_2_Glu_DH, NAD(P) binding domain 1e-130
pfam00208237 pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenyl 8e-66
pfam02812131 pfam02812, ELFV_dehydrog_N, Glu/Leu/Phe/Val dehydr 4e-61
PLN02477410 PLN02477, PLN02477, glutamate dehydrogenase 7e-53
cd01076227 cd01076, NAD_bind_1_Glu_DH, NAD(P) binding domain 5e-33
smart00839102 smart00839, ELFV_dehydrog, Glutamate/Leucine/Pheny 5e-28
cd05211217 cd05211, NAD_bind_Glu_Leu_Phe_Val, NAD(P) binding 6e-26
cd01075200 cd01075, NAD_bind_Leu_Phe_Val_DH, NAD(P) binding d 1e-04
>gnl|CDD|181834 PRK09414, PRK09414, glutamate dehydrogenase; Provisional Back     alignment and domain information
 Score =  612 bits (1582), Expect = 0.0
 Identities = 220/445 (49%), Positives = 309/445 (69%), Gaps = 11/445 (2%)

Query: 195 SIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYV--NIMERLLEPERMIVFRVPWV 252
           S++E   KR+P + EF Q+V+E L +L  V+ KN  Y    I+ERL+EPER+I+FRVPWV
Sbjct: 9   SVLEQVKKRNPGQPEFHQAVREVLESLWPVLEKNPEYAEAGILERLVEPERVIIFRVPWV 68

Query: 253 DDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAA 312
           DD+G+  VNRGFRVQF+ A+GP +GGLRFHPS+NLSI KFLGFEQ  KNAL+   +GG  
Sbjct: 69  DDKGQVQVNRGFRVQFNSAIGPYKGGLRFHPSVNLSILKFLGFEQIFKNALTGLPIGGGK 128

Query: 313 GGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAG 372
           GGSDFDPKGKSD EIMRFCQSFM E++R++GPD D+P+ ++GVG RE+GYLFGQY+RL  
Sbjct: 129 GGSDFDPKGKSDAEIMRFCQSFMTELYRHIGPDTDVPAGDIGVGGREIGYLFGQYKRLTN 188

Query: 373 HFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVL 432
            F+G  TG  + + GS +RTEATGYGLV+FA+ +L       +G R VVSGSG +A++ +
Sbjct: 189 RFEGVLTGKGLSFGGSLIRTEATGYGLVYFAEEMLKARGDSFEGKRVVVSGSGNVAIYAI 248

Query: 433 EKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQR-SLRDYSKTYARSKYYDE 491
           EK    GA  V+ SD+ GY+ DE+G D  K   L++IK  +R  + +Y++ +  ++Y + 
Sbjct: 249 EKAQQLGAKVVTCSDSSGYVYDEEGIDLEK---LKEIKEVRRGRISEYAEEFG-AEYLEG 304

Query: 492 AKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIA 551
             PW+  CD+A PCA+QNE+D+ DA  L+ +G + + EG+NMP TPEA++V  +A VL A
Sbjct: 305 GSPWSVPCDIALPCATQNELDEEDAKTLIANGVKAVAEGANMPSTPEAIEVFLEAGVLFA 364

Query: 552 PAMAAGAGGVVAGELELNQECNMVHWSPEDFESKLQEAMKQTYQRALKAATDFGYQKESP 611
           P  AA AGGV    LE++Q  + + W+ E+ +++L + MK  +   ++ A ++G     P
Sbjct: 365 PGKAANAGGVATSGLEMSQNASRLSWTFEEVDARLHDIMKNIHHACVETAEEYG----KP 420

Query: 612 EALVHGAVISSFLTIAQAMTDQGCV 636
              V GA I+ F+ +A AM  QG +
Sbjct: 421 GNYVAGANIAGFVKVADAMLAQGVI 445


Length = 445

>gnl|CDD|185433 PTZ00079, PTZ00079, NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184463 PRK14030, PRK14030, glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184464 PRK14031, PRK14031, glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223411 COG0334, GdhA, Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|133455 cd05313, NAD_bind_2_Glu_DH, NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>gnl|CDD|215789 pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>gnl|CDD|202408 pfam02812, ELFV_dehydrog_N, Glu/Leu/Phe/Val dehydrogenase, dimerisation domain Back     alignment and domain information
>gnl|CDD|178095 PLN02477, PLN02477, glutamate dehydrogenase Back     alignment and domain information
>gnl|CDD|133445 cd01076, NAD_bind_1_Glu_DH, NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>gnl|CDD|214847 smart00839, ELFV_dehydrog, Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>gnl|CDD|133450 cd05211, NAD_bind_Glu_Leu_Phe_Val, NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>gnl|CDD|133444 cd01075, NAD_bind_Leu_Phe_Val_DH, NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 636
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 100.0
PRK14030445 glutamate dehydrogenase; Provisional 100.0
PRK14031444 glutamate dehydrogenase; Provisional 100.0
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 100.0
PRK09414445 glutamate dehydrogenase; Provisional 100.0
PLN02477410 glutamate dehydrogenase 100.0
KOG2250514 consensus Glutamate/leucine/phenylalanine/valine d 100.0
PTZ003241002 glutamate dehydrogenase 2; Provisional 100.0
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 100.0
PF00208244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 100.0
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 100.0
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 100.0
PF02812131 ELFV_dehydrog_N: Glu/Leu/Phe/Val dehydrogenase, di 100.0
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 100.0
smart00839102 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Vali 99.96
COG2902 1592 NAD-specific glutamate dehydrogenase [Amino acid t 99.91
PF05088 1528 Bac_GDH: Bacterial NAD-glutamate dehydrogenase 99.89
PRK08374 336 homoserine dehydrogenase; Provisional 99.07
PRK06392326 homoserine dehydrogenase; Provisional 99.03
PRK06270 341 homoserine dehydrogenase; Provisional 98.59
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 98.55
PLN02700 377 homoserine dehydrogenase family protein 98.17
PRK06813 346 homoserine dehydrogenase; Validated 98.06
PRK09436 819 thrA bifunctional aspartokinase I/homoserine dehyd 97.83
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.5
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.48
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.41
PRK09466 810 metL bifunctional aspartate kinase II/homoserine d 97.31
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.15
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.04
PTZ00317559 NADP-dependent malic enzyme; Provisional 96.96
COG0460 333 ThrA Homoserine dehydrogenase [Amino acid transpor 96.9
PRK12861 764 malic enzyme; Reviewed 96.84
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 96.71
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 96.71
COG0281432 SfcA Malic enzyme [Energy production and conversio 96.64
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.63
PTZ00075476 Adenosylhomocysteinase; Provisional 96.63
PLN03129581 NADP-dependent malic enzyme; Provisional 96.54
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 96.5
smart0059790 ZnF_TTF zinc finger in transposases and transcript 96.34
PRK00048257 dihydrodipicolinate reductase; Provisional 96.32
PRK13243333 glyoxylate reductase; Reviewed 96.31
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 96.28
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 96.25
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.23
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.23
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 96.2
PRK13529563 malate dehydrogenase; Provisional 96.12
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.09
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 96.08
PRK13302271 putative L-aspartate dehydrogenase; Provisional 96.02
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 95.99
COG0057 335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 95.93
PRK07574385 formate dehydrogenase; Provisional 95.91
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 95.88
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 95.88
PRK12862 763 malic enzyme; Reviewed 95.87
PRK13535 336 erythrose 4-phosphate dehydrogenase; Provisional 95.83
PLN03139386 formate dehydrogenase; Provisional 95.81
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 95.79
PRK13304265 L-aspartate dehydrogenase; Reviewed 95.78
PRK06932314 glycerate dehydrogenase; Provisional 95.73
TIGR01532325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 95.72
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 95.72
PLN02928347 oxidoreductase family protein 95.69
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 95.63
PRK00676338 hemA glutamyl-tRNA reductase; Validated 95.59
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 95.51
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.48
PRK06436303 glycerate dehydrogenase; Provisional 95.46
PLN02494477 adenosylhomocysteinase 95.45
PF00044151 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, 95.44
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 95.41
PRK06487317 glycerate dehydrogenase; Provisional 95.37
COG5322351 Predicted dehydrogenase [General function predicti 95.34
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 95.27
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 95.19
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.17
PRK06349 426 homoserine dehydrogenase; Provisional 95.12
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 95.04
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 94.98
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 94.96
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 94.94
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 94.94
PLN02358 338 glyceraldehyde-3-phosphate dehydrogenase 94.93
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 94.92
PRK15425 331 gapA glyceraldehyde-3-phosphate dehydrogenase A; P 94.92
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 94.91
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.9
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.87
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 94.86
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.79
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 94.73
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 94.71
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 94.69
PTZ00023 337 glyceraldehyde-3-phosphate dehydrogenase; Provisio 94.63
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.62
PLN03096 395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 94.61
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 94.59
TIGR01534327 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, 94.43
PRK08955 334 glyceraldehyde-3-phosphate dehydrogenase; Validate 94.41
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.35
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 94.32
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 94.26
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 94.2
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 94.16
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.16
TIGR00036266 dapB dihydrodipicolinate reductase. 94.15
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.14
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.12
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 94.1
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.08
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 94.06
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 94.04
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.02
PLN02272 421 glyceraldehyde-3-phosphate dehydrogenase 93.99
PRK07403 337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 93.98
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 93.92
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.9
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.88
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 93.86
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.85
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.68
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 93.67
PRK13303265 L-aspartate dehydrogenase; Provisional 93.64
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 93.63
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.61
PRK07729 343 glyceraldehyde-3-phosphate dehydrogenase; Validate 93.57
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.53
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 93.49
PRK08300302 acetaldehyde dehydrogenase; Validated 93.49
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 93.47
PRK11579 346 putative oxidoreductase; Provisional 93.43
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.38
PRK06141314 ornithine cyclodeaminase; Validated 93.35
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 93.31
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 93.29
TIGR01546 333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 93.26
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 93.26
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.15
TIGR01921 324 DAP-DH diaminopimelate dehydrogenase. This model r 93.1
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.07
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 93.06
COG1023 300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 93.04
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 93.0
PLN02237 442 glyceraldehyde-3-phosphate dehydrogenase B 92.96
PRK13301267 putative L-aspartate dehydrogenase; Provisional 92.95
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 92.95
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 92.78
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 92.69
PRK06719157 precorrin-2 dehydrogenase; Validated 92.63
PLN00203519 glutamyl-tRNA reductase 92.6
KOG0068406 consensus D-3-phosphoglycerate dehydrogenase, D-is 92.58
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 92.52
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 92.5
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 92.47
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 92.44
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.43
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 92.42
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.36
PRK06718202 precorrin-2 dehydrogenase; Reviewed 92.35
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 92.34
PRK08223287 hypothetical protein; Validated 92.27
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 92.21
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.18
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 92.17
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 92.1
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 92.09
COG2130340 Putative NADP-dependent oxidoreductases [General f 92.09
PRK08618325 ornithine cyclodeaminase; Validated 92.05
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 92.04
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.86
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 91.84
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 91.83
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 91.72
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 91.7
COG0569225 TrkA K+ transport systems, NAD-binding component [ 91.7
PRK15116268 sulfur acceptor protein CsdL; Provisional 91.68
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.67
PRK12480330 D-lactate dehydrogenase; Provisional 91.62
PRK12548289 shikimate 5-dehydrogenase; Provisional 91.42
PRK13940414 glutamyl-tRNA reductase; Provisional 91.42
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 91.24
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 91.22
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 91.07
PRK08289 477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 90.84
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 90.76
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 90.74
COG0673 342 MviM Predicted dehydrogenases and related proteins 90.68
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.62
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 90.59
PLN02306386 hydroxypyruvate reductase 90.56
PRK14027283 quinate/shikimate dehydrogenase; Provisional 90.53
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 90.5
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 90.3
PRK07680273 late competence protein ComER; Validated 90.29
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 90.23
PRK14851 679 hypothetical protein; Provisional 90.2
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.19
PRK10206 344 putative oxidoreductase; Provisional 90.05
PLN02353 473 probable UDP-glucose 6-dehydrogenase 89.87
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 89.78
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 89.78
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.71
cd01483143 E1_enzyme_family Superfamily of activating enzymes 89.66
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 89.43
PRK07877 722 hypothetical protein; Provisional 89.16
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 89.04
PRK07340304 ornithine cyclodeaminase; Validated 89.01
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 88.78
PRK13403335 ketol-acid reductoisomerase; Provisional 88.56
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 88.47
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 88.31
PTZ00434 361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 88.21
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 88.16
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 88.06
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 87.95
TIGR01761 343 thiaz-red thiazolinyl imide reductase. This reduct 87.91
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 87.89
PRK14852 989 hypothetical protein; Provisional 87.81
PRK14982340 acyl-ACP reductase; Provisional 87.49
PRK03659601 glutathione-regulated potassium-efflux system prot 87.43
PRK12550272 shikimate 5-dehydrogenase; Reviewed 87.28
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 87.27
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.25
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 87.19
PRK08605332 D-lactate dehydrogenase; Validated 87.16
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.11
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 86.99
PRK06046326 alanine dehydrogenase; Validated 86.67
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 86.58
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 86.48
PRK15059292 tartronate semialdehyde reductase; Provisional 86.26
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.16
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 86.03
PLN02688266 pyrroline-5-carboxylate reductase 85.95
KOG1370434 consensus S-adenosylhomocysteine hydrolase [Coenzy 85.88
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 85.81
KOG2380 480 consensus Prephenate dehydrogenase (NADP+) [Amino 85.73
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 85.7
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 85.69
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 85.67
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 85.65
PRK05479330 ketol-acid reductoisomerase; Provisional 85.61
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 85.52
PRK07417279 arogenate dehydrogenase; Reviewed 85.52
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 85.25
PRK05717255 oxidoreductase; Validated 85.07
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.83
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.76
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 84.67
PTZ00353 342 glycosomal glyceraldehyde-3-phosphate dehydrogenas 84.52
KOG1257582 consensus NADP+-dependent malic enzyme [Energy pro 84.42
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 84.37
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 84.37
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.34
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 84.04
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 83.9
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 83.83
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 83.74
PRK08628258 short chain dehydrogenase; Provisional 83.7
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 83.63
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 83.39
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 83.24
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 83.16
PRK03562621 glutathione-regulated potassium-efflux system prot 82.99
COG2085211 Predicted dinucleotide-binding enzymes [General fu 82.9
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 82.85
PRK12828239 short chain dehydrogenase; Provisional 82.8
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 82.74
PLN02712667 arogenate dehydrogenase 82.71
PRK07523255 gluconate 5-dehydrogenase; Provisional 82.49
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 82.37
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 82.37
PLN02858 1378 fructose-bisphosphate aldolase 82.25
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 82.18
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 82.16
PRK06138252 short chain dehydrogenase; Provisional 81.93
PRK07060245 short chain dehydrogenase; Provisional 81.92
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 81.85
PRK10669558 putative cation:proton antiport protein; Provision 81.77
PRK08328231 hypothetical protein; Provisional 81.64
PRK06841255 short chain dehydrogenase; Provisional 81.39
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 81.38
PRK05562223 precorrin-2 dehydrogenase; Provisional 81.35
COG2344211 AT-rich DNA-binding protein [General function pred 81.35
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 81.18
CHL00073457 chlN photochlorophyllide reductase subunit N 80.91
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 80.82
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 80.74
PRK06523260 short chain dehydrogenase; Provisional 80.6
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 80.59
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 80.26
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 80.26
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 80.25
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 80.23
PLN02858 1378 fructose-bisphosphate aldolase 80.21
PLN02240 352 UDP-glucose 4-epimerase 80.17
PRK12938246 acetyacetyl-CoA reductase; Provisional 80.12
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 80.05
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 80.05
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
Probab=100.00  E-value=6.1e-139  Score=1127.76  Aligned_cols=443  Identities=49%  Similarity=0.928  Sum_probs=431.5

Q ss_pred             hhhHHHHHHHHHhhCCCCccHHHHHHHHHHHHHHHHHhCccchHHHHhhcCCCeEEEEEEeEEcCCCCEEEEEEEEEEec
Q 006655          190 SKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFS  269 (636)
Q Consensus       190 ~~~~~~~~~~~~~~~p~~~ef~q~v~e~~~~~~~~l~~~p~y~~i~e~L~ePer~i~f~vp~~dd~G~v~v~rGyRVqhs  269 (636)
                      .++++++++.+++|+|+|+||+|||+|+++|+.|+|+++|+|.+++++|++|+|+|+|+|||+||+|++++|+|||||||
T Consensus        11 ~~~~~~~~~~~~~~~~~~~ef~qa~~e~~~~~~~~~~~~~~y~~i~e~l~~Per~i~~~vp~~~D~G~v~v~~GyRVqhn   90 (454)
T PTZ00079         11 AQEMDALRKRVKSRDPNQPEFLQAFHEVMTSLKPLFQKNPKYLGVLERLVEPERVIQFRVPWVDDKGEQRVNRGFRVQYN   90 (454)
T ss_pred             HHHHHHHHHHHHHhCCCChHHHHHHHHHHHHHHHHHHhChhHHHHHHHhccCceEEEEEEEEEECCCCEEEEeeEEEEEc
Confidence            45578999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCeEEecCCCHHHHHHHHHHhhhhhccCCCCCCCceEEEeCCCCCCCHHHHHHHHHHHHHHHHhhcCCCCccc
Q 006655          270 QALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLP  349 (636)
Q Consensus       270 ~alGPakGGlRfhp~v~~~evkaLA~~MT~KnAL~gLP~GGaKGGI~~DP~~~S~~El~r~~r~f~~eL~~~IGp~~DVp  349 (636)
                      +++|||||||||||+||++++++||++|||||||++||||||||||+|||+++|+.|+|||||+||++|.+||||++|||
T Consensus        91 ~alGP~kGGlRfhp~v~~~~vk~La~~mt~KnAl~gLP~GGgKGGi~~dPk~~s~~El~r~~r~f~~eL~~~IGp~~Dvp  170 (454)
T PTZ00079         91 SALGPYKGGLRFHPSVNLSILKFLGFEQIFKNSLTTLPMGGGKGGSDFDPKGKSDNEVMRFCQSFMTELYRHIGPDTDVP  170 (454)
T ss_pred             CCCCCCCCCEEeeCCCCHHHHHHHHHHHHHHHHhcCCCCCCcceeeecCCCCCCHHHHHHHHHHHHHHHHHhcCCCCccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCChhHHHHHHHHhhhhhCCCCccccCcccccCCCCCCCCcchhHHHHHHHHHHHHhCCCCCCcEEEEecCccHHH
Q 006655          350 SEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAM  429 (636)
Q Consensus       350 A~DiGt~~rem~~m~~~y~~l~g~~~g~vTGKp~~~GGs~~r~eATG~GV~~~~~~~l~~~g~~l~GkrVaIqGfGNVG~  429 (636)
                      ||||||+++||+||+++|+++++.++|++||||+.+|||.+|++||||||+|++++++++.+.+|+|+||+||||||||+
T Consensus       171 A~DvGt~~rem~~~~~~y~~~~~~~~gv~TGK~~~~GGs~~r~eATG~Gv~~~~~~~l~~~~~~l~Gk~VaVqG~GnVg~  250 (454)
T PTZ00079        171 AGDIGVGGREIGYLFGQYKKLRNNFEGTLTGKNVKWGGSNIRPEATGYGLVYFVLEVLKKLNDSLEGKTVVVSGSGNVAQ  250 (454)
T ss_pred             hhhcCCCHHHHHHHHHHHHHHhCCCCceeCCCCCCCCCCCCCCcccHHHHHHHHHHHHHHcCCCcCCCEEEEECCCHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHCCCEEEEEeCCCCceeCCCCCCHHHHHHHHHHHhhc-CCccccccccCCceeeCCCCccccccceEecCCCc
Q 006655          430 HVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQ-RSLRDYSKTYARSKYYDEAKPWNERCDVAFPCASQ  508 (636)
Q Consensus       430 ~aAe~L~e~GAkVVaVSDs~G~IydpdGLDve~L~~L~~~k~~~-g~l~~y~~~~p~a~~i~~~eil~~~cDIliPcA~~  508 (636)
                      ++|++|++.|+|||+|||++|+||||+|||+++|..|.++|+.+ +++.+|...++++++++++++|+++||||+|||++
T Consensus       251 ~aa~~L~e~GakVVavSD~~G~iy~~~Gld~~~l~~l~~~k~~~~g~i~~~~~~~~~a~~~~~~~~~~~~cDI~iPcA~~  330 (454)
T PTZ00079        251 YAVEKLLQLGAKVLTMSDSDGYIHEPNGFTKEKLAYLMDLKNVKRGRLKEYAKHSSTAKYVPGKKPWEVPCDIAFPCATQ  330 (454)
T ss_pred             HHHHHHHHCCCEEEEEEcCCCcEECCCCCCHHHHHHHHHHHhhcCCcHHhhhhccCCcEEeCCcCcccCCccEEEecccc
Confidence            99999999999999999999999999999999998889998765 78988876677899999999999999999999999


Q ss_pred             CccchhhHHHhhhcCceEEEeCCCCCCCHHHHHHHHHCCceEecccccccccceeecchhccccCCCCCCHHHHHHHHHH
Q 006655          509 NEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGGVVAGELELNQECNMVHWSPEDFESKLQE  588 (636)
Q Consensus       509 n~It~enA~~l~~~~akiVvEgAN~P~T~eA~~iL~~rGIlviPD~~aNAGGVivS~~E~~qN~~~~~ws~eeV~~rL~~  588 (636)
                      |+||.+||++|++++||+|+||||||+|++|+++|++|||+|+||+++|||||++|||||+||+++++|++|||++||++
T Consensus       331 n~I~~~~a~~l~~~~ak~V~EgAN~p~t~eA~~~L~~~GI~~~PD~~aNAGGV~vS~~E~~Qn~~~~~W~~eeV~~~L~~  410 (454)
T PTZ00079        331 NEINLEDAKLLIKNGCKLVAEGANMPTTIEATHLFKKNGVIFCPGKAANAGGVAISGLEMSQNAARLQWTAEEVDEKLRE  410 (454)
T ss_pred             ccCCHHHHHHHHHcCCeEEEecCCCCCCHHHHHHHHHCCcEEEChhhhcCCCeeeehHHhhhhhcccCCCHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHcCCCCCCCccHHHHHHHHHHHHHHHHHHhcCCC
Q 006655          589 AMKQTYQRALKAATDFGYQKESPEALVHGAVISSFLTIAQAMTDQGCV  636 (636)
Q Consensus       589 ~m~~~~~~v~~~A~~~~~~~~~~~~~~~aA~i~a~~rVa~Am~~~G~~  636 (636)
                      +|.++|++|+++|++++.    ..+||.||||+||.|||+||++||+|
T Consensus       411 ~M~~~~~~~~~~a~~~~~----~~~~r~~A~i~~~~rva~Am~~~G~~  454 (454)
T PTZ00079        411 IMKSIFEACVKYAEKYGG----KSDLVAGANIAGFLKVADSMIEQGCV  454 (454)
T ss_pred             HHHHHHHHHHHHHHHhCC----CCCHHHHHHHHHHHHHHHHHHhcCCC
Confidence            999999999999999963    23899999999999999999999986



>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>KOG2250 consensus Glutamate/leucine/phenylalanine/valine dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00324 glutamate dehydrogenase 2; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF02812 ELFV_dehydrog_N: Glu/Leu/Phe/Val dehydrogenase, dimerisation domain; InterPro: IPR006097 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>smart00839 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>COG2902 NAD-specific glutamate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05088 Bac_GDH: Bacterial NAD-glutamate dehydrogenase Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PLN02700 homoserine dehydrogenase family protein Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PTZ00317 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>smart00597 ZnF_TTF zinc finger in transposases and transcription factors Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG1257 consensus NADP+-dependent malic enzyme [Energy production and conversion] Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>CHL00073 chlN photochlorophyllide reductase subunit N Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query636
3r3j_A456 Kinetic And Structural Characterization Of Plasmodi 1e-124
2bma_A470 The Crystal Structure Of Plasmodium Falciparum Glut 1e-111
2yfh_A448 Structure Of A Chimeric Glutamate Dehydrogenase Len 1e-107
4fcc_A450 Glutamate Dehydrogenase From E. Coli Length = 450 1e-105
3sbo_A447 Structure Of E.Coli Gdh From Native Source Length = 1e-105
2yfg_E447 Structural Determinants Of Cofactor Specificity And 1e-105
1hrd_A449 Glutamate Dehydrogenase Length = 449 4e-98
1k89_A449 K89l Mutant Of Glutamate Dehydrogenase Length = 449 9e-98
1aup_A449 Glutamate Dehydrogenase Length = 449 1e-97
3aog_A440 Crystal Structure Of Glutamate Dehydrogenase (Gdhb) 2e-38
3aoe_A424 Crystal Structure Of Hetero-Hexameric Glutamate Deh 2e-38
3k92_A424 Crystal Structure Of A E93k Mutant Of The Majour Ba 3e-38
1b3b_A415 Thermotoga Maritima Glutamate Dehydrogenase Mutant 2e-37
1euz_A419 Glutamate Dehydrogenase From Thermococcus Profundus 4e-37
1b26_A416 Glutamate Dehydrogenase Length = 416 4e-37
1bvu_A418 Glutamate Dehydrogenase From Thermococcus Litoralis 2e-35
1v9l_A421 L-Glutamate Dehydrogenase From Pyrobaculum Islandic 2e-34
1gtm_A419 Structure Of Glutamate Dehydrogenase Length = 419 3e-34
3k8z_A423 Crystal Structure Of Gudb1 A Decryptified Secondary 4e-34
2tmg_A415 Thermotoga Maritima Glutamate Dehydrogenase Mutant 5e-34
1l1f_A505 Structure Of Human Glutamate Dehydrogenase-Apo Form 1e-32
1nr1_A496 Crystal Structure Of The R463a Mutant Of Human Glut 1e-32
3mw9_A501 Bovine Glutamate Dehydrogenase Complexed With Nadh, 1e-32
3etd_A501 Structure Of Glutamate Dehydrogenase Complexed With 3e-32
1nqt_A496 Crystal Structure Of Bovine Glutamate Dehydrogenase 4e-32
3aoe_E419 Crystal Structure Of Hetero-Hexameric Glutamate Deh 7e-32
1hwy_A501 Bovine Glutamate Dehydrogenase Complexed With Nad A 7e-30
2yfq_A421 Crystal Structure Of Glutamate Dehydrogenase From P 1e-27
>pdb|3R3J|A Chain A, Kinetic And Structural Characterization Of Plasmodium Falciparum Glutamate Dehydrogenase 2 Length = 456 Back     alignment and structure

Iteration: 1

Score = 442 bits (1137), Expect = e-124, Method: Compositional matrix adjust. Identities = 200/438 (45%), Positives = 307/438 (70%), Gaps = 5/438 (1%) Query: 198 EAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGE 257 E + ++ +E EF+Q+ +E L L+ V K++ Y+ ++E + EPER+I FRVPW++D+GE Sbjct: 21 EKVVSKNKNEPEFLQAFEEVLSCLKPVFKKDNVYIGVLENIAEPERVIQFRVPWINDKGE 80 Query: 258 THVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDF 317 +NRGFRVQ++ LGP +GGLRFHP++NLS+ KFLGFEQ KN+L+ +GG GGSDF Sbjct: 81 HKMNRGFRVQYNSVLGPYKGGLRFHPAVNLSVIKFLGFEQIFKNSLTTLPMGGGKGGSDF 140 Query: 318 DPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGS 377 DPKGKS+NEI++FCQSFM + RY+GP+ D+P+ ++GVG RE+GYLFGQY++L F+G Sbjct: 141 DPKGKSENEILKFCQSFMTNLFRYIGPNTDVPAGDIGVGGREIGYLFGQYKKLKNSFEGV 200 Query: 378 FTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIA 437 TG I W GS++R EATGYG+V+FA+ +L D+N L+ +C+VSGSG +A +++EKLI Sbjct: 201 LTGKNIKWGGSNIRAEATGYGVVYFAENVLKDLNDNLENKKCLVSGSGNVAQYLVEKLIE 260 Query: 438 YGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQR-SLRDYSKTYARSKYYDEAKPWN 496 GAI +++SD+ GY+++ +GF +++++ DIK+ QR L++Y K +KY++ KPWN Sbjct: 261 KGAIVLTMSDSNGYILEPNGFTKEQLNYIMDIKNNQRLRLKEYLKYSKTAKYFENQKPWN 320 Query: 497 ERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMXX 556 CD+AFPCA+QNEI+++DA + + C+++VEG+NMP +A+ LK+ N+++ P+ Sbjct: 321 IPCDIAFPCATQNEINENDADLFIQNKCKMIVEGANMPTHIKALHKLKQNNIILCPSKAA 380 Query: 557 XXXXXXXXELELNQECNMVHWSPEDFESKLQEAMKQTYQRALKAATDFGYQKESPEALVH 616 LE++Q + W+ ++ + KLQ MK Y++ + Y ES LV Sbjct: 381 NAGGVAVSGLEMSQNSMRLQWTHQETDMKLQNIMKSIYEQCHNTSKI--YLNESD--LVA 436 Query: 617 GAVISSFLTIAQAMTDQG 634 GA I+ FL +A + +QG Sbjct: 437 GANIAGFLKVADSFLEQG 454
>pdb|2BMA|A Chain A, The Crystal Structure Of Plasmodium Falciparum Glutamate Dehydrogenase, A Putative Target For Novel Antimalarial Drugs Length = 470 Back     alignment and structure
>pdb|2YFH|A Chain A, Structure Of A Chimeric Glutamate Dehydrogenase Length = 448 Back     alignment and structure
>pdb|4FCC|A Chain A, Glutamate Dehydrogenase From E. Coli Length = 450 Back     alignment and structure
>pdb|3SBO|A Chain A, Structure Of E.Coli Gdh From Native Source Length = 447 Back     alignment and structure
>pdb|2YFG|E Chain E, Structural Determinants Of Cofactor Specificity And Domain Flexibility In Bacterial Glutamate Dehydrogenases Length = 447 Back     alignment and structure
>pdb|1HRD|A Chain A, Glutamate Dehydrogenase Length = 449 Back     alignment and structure
>pdb|1K89|A Chain A, K89l Mutant Of Glutamate Dehydrogenase Length = 449 Back     alignment and structure
>pdb|1AUP|A Chain A, Glutamate Dehydrogenase Length = 449 Back     alignment and structure
>pdb|3AOG|A Chain A, Crystal Structure Of Glutamate Dehydrogenase (Gdhb) From Thermus Thermophilus (Glu Bound Form) Length = 440 Back     alignment and structure
>pdb|3AOE|A Chain A, Crystal Structure Of Hetero-Hexameric Glutamate Dehydrogenase From Thermus Thermophilus (Leu Bound Form) Length = 424 Back     alignment and structure
>pdb|3K92|A Chain A, Crystal Structure Of A E93k Mutant Of The Majour Bacillus Su Glutamate Dehydrogenase Rocg Length = 424 Back     alignment and structure
>pdb|1B3B|A Chain A, Thermotoga Maritima Glutamate Dehydrogenase Mutant N97d, G376k Length = 415 Back     alignment and structure
>pdb|1EUZ|A Chain A, Glutamate Dehydrogenase From Thermococcus Profundus In The Unligated State Length = 419 Back     alignment and structure
>pdb|1B26|A Chain A, Glutamate Dehydrogenase Length = 416 Back     alignment and structure
>pdb|1BVU|A Chain A, Glutamate Dehydrogenase From Thermococcus Litoralis Length = 418 Back     alignment and structure
>pdb|1V9L|A Chain A, L-Glutamate Dehydrogenase From Pyrobaculum Islandicum Complexed With Nad Length = 421 Back     alignment and structure
>pdb|1GTM|A Chain A, Structure Of Glutamate Dehydrogenase Length = 419 Back     alignment and structure
>pdb|3K8Z|A Chain A, Crystal Structure Of Gudb1 A Decryptified Secondary Glutamate Dehydrogenase From B. Subtilis Length = 423 Back     alignment and structure
>pdb|2TMG|A Chain A, Thermotoga Maritima Glutamate Dehydrogenase Mutant S128r, T158e, N117r, S160e Length = 415 Back     alignment and structure
>pdb|1L1F|A Chain A, Structure Of Human Glutamate Dehydrogenase-Apo Form Length = 505 Back     alignment and structure
>pdb|1NR1|A Chain A, Crystal Structure Of The R463a Mutant Of Human Glutamate Dehydrogenase Length = 496 Back     alignment and structure
>pdb|3MW9|A Chain A, Bovine Glutamate Dehydrogenase Complexed With Nadh, Gtp, Glu Length = 501 Back     alignment and structure
>pdb|3ETD|A Chain A, Structure Of Glutamate Dehydrogenase Complexed With Bithionol Length = 501 Back     alignment and structure
>pdb|1NQT|A Chain A, Crystal Structure Of Bovine Glutamate Dehydrogenase-adp Complex Length = 496 Back     alignment and structure
>pdb|3AOE|E Chain E, Crystal Structure Of Hetero-Hexameric Glutamate Dehydrogenase From Thermus Thermophilus (Leu Bound Form) Length = 419 Back     alignment and structure
>pdb|1HWY|A Chain A, Bovine Glutamate Dehydrogenase Complexed With Nad And 2-Oxoglutarate Length = 501 Back     alignment and structure
>pdb|2YFQ|A Chain A, Crystal Structure Of Glutamate Dehydrogenase From Peptoniphilus Asaccharolyticus Length = 421 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query636
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 0.0
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 0.0
2yfg_A447 NADP-specific glutamate dehydrogenase; oxidoreduct 0.0
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 0.0
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 1e-156
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 1e-149
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 1e-149
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 1e-145
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 1e-140
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 1e-139
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 1e-137
3mw9_A501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 1e-109
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 6e-40
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 3e-36
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Length = 456 Back     alignment and structure
 Score =  688 bits (1778), Expect = 0.0
 Identities = 203/449 (45%), Positives = 315/449 (70%), Gaps = 5/449 (1%)

Query: 189 MSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFR 248
           +      + E  + ++ +E EF+Q+ +E L  L+ V  K++ Y+ ++E + EPER+I FR
Sbjct: 12  VDNQIEELREKVVSKNKNEPEFLQAFEEVLSCLKPVFKKDNVYIGVLENIAEPERVIQFR 71

Query: 249 VPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKL 308
           VPW++D+GE  +NRGFRVQ++  LGP +GGLRFHP++NLS+ KFLGFEQ  KN+L+   +
Sbjct: 72  VPWINDKGEHKMNRGFRVQYNSVLGPYKGGLRFHPAVNLSVIKFLGFEQIFKNSLTTLPM 131

Query: 309 GGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYR 368
           GG  GGSDFDPKGKS+NEI++FCQSFM  + RY+GP+ D+P+ ++GVG RE+GYLFGQY+
Sbjct: 132 GGGKGGSDFDPKGKSENEILKFCQSFMTNLFRYIGPNTDVPAGDIGVGGREIGYLFGQYK 191

Query: 369 RLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIA 428
           +L   F+G  TG  I W GS++R EATGYG+V+FA+ +L D+N  L+  +C+VSGSG +A
Sbjct: 192 KLKNSFEGVLTGKNIKWGGSNIRAEATGYGVVYFAENVLKDLNDNLENKKCLVSGSGNVA 251

Query: 429 MHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQR-SLRDYSKTYARSK 487
            +++EKLI  GAI +++SD+ GY+++ +GF   +++++ DIK+ QR  L++Y K    +K
Sbjct: 252 QYLVEKLIEKGAIVLTMSDSNGYILEPNGFTKEQLNYIMDIKNNQRLRLKEYLKYSKTAK 311

Query: 488 YYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKAN 547
           Y++  KPWN  CD+AFPCA+QNEI+++DA   + + C+++VEG+NMP   +A+  LK+ N
Sbjct: 312 YFENQKPWNIPCDIAFPCATQNEINENDADLFIQNKCKMIVEGANMPTHIKALHKLKQNN 371

Query: 548 VLIAPAMAAGAGGVVAGELELNQECNMVHWSPEDFESKLQEAMKQTYQRALKAATDFGYQ 607
           +++ P+ AA AGGV    LE++Q    + W+ ++ + KLQ  MK  Y++    +  +   
Sbjct: 372 IILCPSKAANAGGVAVSGLEMSQNSMRLQWTHQETDMKLQNIMKSIYEQCHNTSKIYL-- 429

Query: 608 KESPEALVHGAVISSFLTIAQAMTDQGCV 636
             +   LV GA I+ FL +A +  +QG +
Sbjct: 430 --NESDLVAGANIAGFLKVADSFLEQGGL 456


>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Length = 470 Back     alignment and structure
>2yfg_A NADP-specific glutamate dehydrogenase; oxidoreductase; 2.50A {Escherichia coli} PDB: 3sbo_A 2yfg_E Length = 447 Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Length = 449 Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Length = 419 Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Length = 424 Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Length = 421 Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Length = 440 Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Length = 415 Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Length = 419 Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Length = 421 Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Length = 501 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Length = 364 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Length = 355 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query636
4fcc_A450 Glutamate dehydrogenase; protein complex, rossmann 100.0
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 100.0
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 100.0
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 100.0
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 100.0
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 100.0
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 100.0
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 100.0
3mw9_A501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 100.0
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 100.0
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 100.0
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 100.0
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 100.0
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 100.0
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 97.85
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 97.53
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 97.35
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 97.25
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.23
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 97.13
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 97.03
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 96.92
2rir_A300 Dipicolinate synthase, A chain; structural genomic 96.84
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 96.81
3p2o_A285 Bifunctional protein fold; structural genomics, ce 96.81
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 96.8
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 96.77
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 96.77
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 96.73
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 96.71
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 96.71
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 96.7
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 96.7
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 96.69
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 96.6
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 96.52
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 96.44
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 96.44
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 96.4
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 96.36
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 96.35
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 96.35
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 96.34
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 96.34
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 96.32
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 96.32
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 96.25
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 96.25
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 96.25
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 96.19
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 96.18
3l07_A285 Bifunctional protein fold; structural genomics, ID 96.17
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 96.16
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 96.14
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 96.12
1gq2_A555 Malic enzyme; oxidoreductase, pigeon liver, NADP-d 96.12
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 96.08
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 96.05
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.04
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 96.04
1ebf_A 358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 96.02
2ejw_A 332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 96.01
1u8f_O 335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 95.99
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 95.94
3oa2_A 318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 95.93
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 95.93
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 95.91
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 95.91
1obf_O 335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 95.89
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 95.88
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 95.87
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 95.87
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 95.84
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 95.82
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 95.81
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 95.8
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 95.8
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 95.79
1pj3_A564 NAD-dependent malic enzyme, mitochondrial; oxidati 95.79
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 95.78
4had_A 350 Probable oxidoreductase protein; structural genomi 95.77
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 95.71
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 95.71
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 95.71
3l6d_A306 Putative oxidoreductase; structural genomics, prot 95.7
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 95.7
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 95.66
1o0s_A605 NAD-ME, NAD-dependent malic enzyme; oxidoreductase 95.65
3b1j_A 339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 95.64
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 95.63
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 95.61
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 95.6
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 95.59
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.59
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 95.58
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.58
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural g 95.56
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 95.55
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 95.52
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 95.52
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 95.48
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 95.47
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 95.45
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 95.45
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 95.41
2x5j_O 339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 95.41
1rm4_O 337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 95.4
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 95.39
3h9e_O 346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 95.39
3e5r_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 95.38
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 95.38
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 95.36
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 95.35
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 95.35
2ep7_A 342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 95.35
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 95.34
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 95.33
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 95.33
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.31
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 95.31
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 95.29
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 95.29
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 95.28
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 95.28
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 95.28
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 95.25
3c85_A183 Putative glutathione-regulated potassium-efflux S 95.24
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 95.23
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 95.23
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 95.21
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 95.19
2d59_A144 Hypothetical protein PH1109; COA binding, structur 95.18
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 95.16
3cps_A 354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 95.12
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 95.09
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.08
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.07
2g82_O 331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 95.06
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 95.05
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 95.03
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 94.99
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 94.94
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 94.93
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 94.91
1lss_A140 TRK system potassium uptake protein TRKA homolog; 94.88
1ydw_A 362 AX110P-like protein; structural genomics, protein 94.85
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 94.83
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 94.8
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 94.79
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 94.76
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 94.75
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 94.74
1hdg_O 332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 94.7
3nv9_A487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 94.7
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 94.68
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 94.67
1gad_O 330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 94.67
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 94.64
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 94.62
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 94.56
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 94.55
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 94.53
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 94.48
3hja_A 356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 94.47
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 94.41
3qha_A296 Putative oxidoreductase; seattle structural genomi 94.41
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 94.4
2b4r_O 345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 94.4
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 94.33
3cmc_O 334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 94.29
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 94.21
2duw_A145 Putative COA-binding protein; ligand binding prote 94.19
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 94.19
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 94.19
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 94.18
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 94.16
4ew6_A 330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 94.11
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 94.08
3doc_A 335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 94.07
1f06_A 320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 94.06
4h3v_A 390 Oxidoreductase domain protein; structural genomics 94.02
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 94.0
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 93.88
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 93.81
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 93.8
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 93.78
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 93.76
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 93.74
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 93.73
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 93.72
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 93.64
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 93.62
1nvm_B 312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 93.6
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 93.53
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 93.51
3pym_A 332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 93.5
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 93.44
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 93.42
3lvf_P 338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 93.4
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 93.38
4dib_A 345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 93.36
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 93.33
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 93.31
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 93.22
1iuk_A140 Hypothetical protein TT1466; structural genomics, 93.14
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 93.02
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 92.91
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 92.83
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 92.79
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 92.74
4ezb_A317 Uncharacterized conserved protein; structural geno 92.57
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 92.55
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 92.37
3v1y_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 92.22
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 92.17
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 92.15
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 92.14
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 92.13
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 92.1
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 91.99
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 91.99
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 91.92
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 91.85
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 91.83
1vpd_A299 Tartronate semialdehyde reductase; structural geno 91.76
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 91.74
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 91.73
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 91.7
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 91.69
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 91.69
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 91.59
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 91.37
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 91.29
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 91.25
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 91.24
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 91.12
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 91.11
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 90.92
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 90.66
1id1_A153 Putative potassium channel protein; RCK domain, E. 90.54
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 90.43
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 90.22
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 90.17
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 90.16
4eye_A342 Probable oxidoreductase; structural genomics, niai 89.97
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 89.93
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 89.73
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 89.71
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 89.67
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 89.61
3ids_C 359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 89.45
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 89.34
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 89.15
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 89.05
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 88.86
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 88.73
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 88.71
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 88.51
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 88.5
3ip3_A 337 Oxidoreductase, putative; structural genomics, PSI 88.46
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 88.45
1yb4_A295 Tartronic semialdehyde reductase; structural genom 88.43
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 88.41
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 88.27
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 87.98
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 87.93
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 87.9
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 87.86
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 87.64
2nqt_A 352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 87.62
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 87.49
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 87.4
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 86.94
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 86.84
2r00_A 336 Aspartate-semialdehyde dehydrogenase; conformation 86.75
2ep5_A 350 350AA long hypothetical aspartate-semialdehyde deh 86.74
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 86.71
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 86.66
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 86.62
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 86.52
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 86.43
1t4b_A 367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 86.26
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 86.08
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 86.0
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 85.94
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 85.91
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 85.87
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 85.86
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 85.77
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 85.67
1r0k_A 388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 85.6
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 85.21
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 85.14
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 85.06
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 85.05
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 85.02
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 84.85
2hjs_A 340 USG-1 protein homolog; aspartate-semialdehyde dehy 84.83
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 84.75
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 84.62
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 84.49
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 84.41
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 84.41
2yv3_A 331 Aspartate-semialdehyde dehydrogenase; aspartate pa 84.25
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 84.13
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 84.12
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 84.11
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 83.97
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 83.94
4dpl_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 83.8
4dpk_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 83.8
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 83.67
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 83.62
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 83.61
3edm_A259 Short chain dehydrogenase; structural genomics, ox 83.56
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 83.55
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 83.44
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 83.37
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 83.32
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 83.16
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 82.87
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 82.78
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 82.75
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 82.7
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 82.69
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 82.58
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 82.45
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 82.36
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 82.2
3dr3_A 337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 82.11
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 82.07
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 82.0
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 81.95
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 81.95
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 81.88
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 81.83
3pwk_A 366 Aspartate-semialdehyde dehydrogenase; NADP binding 81.73
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 81.61
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 81.61
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 81.54
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 81.51
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 81.45
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 81.43
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 81.39
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 81.27
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 81.27
1nff_A260 Putative oxidoreductase RV2002; directed evolution 81.26
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 81.25
3tz6_A 344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 81.2
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 81.18
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 81.15
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 81.12
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 81.09
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 81.07
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 81.0
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 80.97
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 80.95
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 80.85
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 80.83
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 80.8
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 80.79
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 80.77
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 80.73
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 80.72
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 80.68
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 80.63
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 80.61
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 80.55
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 80.5
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 80.41
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 80.41
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 80.38
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 80.23
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 80.16
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 80.11
3ius_A286 Uncharacterized conserved protein; APC63810, silic 80.09
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 80.08
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 80.06
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 80.05
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 80.04
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 80.03
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 80.02
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
Probab=100.00  E-value=7.5e-137  Score=1113.88  Aligned_cols=441  Identities=44%  Similarity=0.785  Sum_probs=424.2

Q ss_pred             hhhHHHHHHHHHhhCCCCccHHHHHHHHHHHHHHHHHhCccch--HHHHhhcCCCeEEEEEEeEEcCCCCEEEEEEEEEE
Q 006655          190 SKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYV--NIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQ  267 (636)
Q Consensus       190 ~~~~~~~~~~~~~~~p~~~ef~q~v~e~~~~~~~~l~~~p~y~--~i~e~L~ePer~i~f~vp~~dd~G~v~v~rGyRVq  267 (636)
                      ..+++++++.+++|||+|+||+|||.|+++||.|+|++||+|.  .++|+|++|+|+|+|||||+||+|++++|+|||||
T Consensus         7 ~~~~~~~~~~~~~~~~~~~ef~qa~~e~~~~l~~~~~~~p~y~~~~~~e~l~~PeR~i~~~vp~~~D~G~~~v~~GyRvq   86 (450)
T 4fcc_A            7 TYSLESFLNHVQKRDPNQTEFAQAVREVMTTLWPFLEQNPKYRQMSLLERLVEPERVIQFRVVWVDDRNQVQVNRAWRVQ   86 (450)
T ss_dssp             --CHHHHHHHHHTTCTTCHHHHHHHHHHHHHHHHHHHHCGGGTSTTHHHHHTSCSEEEEEEEEEECTTSCEEEEEEEEEE
T ss_pred             hhhHHHHHHHHHhhCcCChHHHHHHHHHHHHHHHHHHhChhhhhhhHHHHHhCCceEEEEEEEEEECCCcEEEEEEEEEE
Confidence            3458999999999999999999999999999999999999998  69999999999999999999999999999999999


Q ss_pred             ecCCCCCCCCCeEEecCCCHHHHHHHHHHhhhhhccCCCCCCCceEEEeCCCCCCCHHHHHHHHHHHHHHHHhhcCCCCc
Q 006655          268 FSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKD  347 (636)
Q Consensus       268 hs~alGPakGGlRfhp~v~~~evkaLA~~MT~KnAL~gLP~GGaKGGI~~DP~~~S~~El~r~~r~f~~eL~~~IGp~~D  347 (636)
                      ||+++|||||||||||+||++|+++||++|||||||++||||||||||+|||+++|+.|+|||||+|+++|.+||||++|
T Consensus        87 hn~alGP~kGG~Rfhp~v~l~ev~~La~~mT~KnAl~gLP~GGgKggi~~DPk~~s~~El~R~~~~f~~eL~~~iG~d~d  166 (450)
T 4fcc_A           87 FSSAIGPYKGGMRFHPSVNLSILKFLGFEQTFKNALTTLPMGGGKGGSDFDPKGKSEGEVMRFCQALMTELYRHLGADTD  166 (450)
T ss_dssp             EECSSSSEEEEEEECTTCCHHHHHHHHHHHHHHHHHTTSSCCEEEEEESCCCTTCCHHHHHHHHHHHHHHHGGGCBTTTE
T ss_pred             ECCCCCCCCCceEecCCCCHHHHHHHHHHHHHHHHHcCCCCCCCceEEecCCCcCCHHHHHHHHHHHHHHhhheecCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCChhHHHHHHHHhhhhhCCCCccccCcccccCCCCCCCCcchhHHHHHHHHHHHHhCCCCCCcEEEEecCccH
Q 006655          348 LPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKI  427 (636)
Q Consensus       348 VpA~DiGt~~rem~~m~~~y~~l~g~~~g~vTGKp~~~GGs~~r~eATG~GV~~~~~~~l~~~g~~l~GkrVaIqGfGNV  427 (636)
                      |||||+||+++||+||+++|+++.+...+++||||+.+|||.+|++||||||++++++++++.+.+++|+||+|||||||
T Consensus       167 vpa~Dig~~~~em~~~~~~y~~~~~~~~~v~TGk~~~~GGs~~r~~aTg~Gv~~~~~~~~~~~~~~l~Gk~vaVQG~GnV  246 (450)
T 4fcc_A          167 VPAGDIGVGGREVGFMAGMMKKLSNNTACVFTGKGLSFGGSLIRPEATGYGLVYFTEAMLKRHGMGFEGMRVSVSGSGNV  246 (450)
T ss_dssp             EEECBTTBCHHHHHHHHHHHHHHHTCCSCCCSSCCGGGTCCTTTTTHHHHHHHHHHHHHHHHTTCCSTTCEEEEECCSHH
T ss_pred             CCccceeecchhhhhhhhhhhhccCCCceeecCCCcccCCCCCCCCceeeeHHHHHHHHHHHcCCCcCCCEEEEeCCChH
Confidence            99999999999999999999999999899999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHCCCEEEEEeCCCCceeCCCCCCHHHHHHHHHHHhhc-CCccccccccCCceeeCCCCccccccceEecCC
Q 006655          428 AMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQ-RSLRDYSKTYARSKYYDEAKPWNERCDVAFPCA  506 (636)
Q Consensus       428 G~~aAe~L~e~GAkVVaVSDs~G~IydpdGLDve~L~~L~~~k~~~-g~l~~y~~~~p~a~~i~~~eil~~~cDIliPcA  506 (636)
                      |+++|++|++.|+|||+|||++|+||||+|||+++|..++++|..+ +++.+|.+.+ ++++++++++|+++||||+|||
T Consensus       247 G~~aa~~L~e~GakvVavsD~~G~i~d~~Gid~e~l~~l~e~k~~~~g~v~~~~~~~-g~~~~~~~~i~~~~~DI~iPcA  325 (450)
T 4fcc_A          247 AQYAIEKAMEFGARVITASDSSGTVVDESGFTKEKLARLIEIKSSRDGRVADYAKEF-GLVYLEGQQPWSVPVDIALPCA  325 (450)
T ss_dssp             HHHHHHHHHHTTCEEEEEEETTEEEECTTCCCHHHHHHHHHHHTSTTCCHHHHHHHH-TCEEEETCCGGGSCCSEEEECS
T ss_pred             HHHHHHHHHhcCCeEEEEecCCceEEeCCCCCHHHHHHHHHHhcccCCccccccccC-CcEEecCcccccCCccEEeecc
Confidence            9999999999999999999999999999999999998888887644 6788876554 7889999999999999999999


Q ss_pred             CcCccchhhHHHhhhcCceEEEeCCCCCCCHHHHHHHHHCCceEecccccccccceeecchhccccCCCCCCHHHHHHHH
Q 006655          507 SQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGGVVAGELELNQECNMVHWSPEDFESKL  586 (636)
Q Consensus       507 ~~n~It~enA~~l~~~~akiVvEgAN~P~T~eA~~iL~~rGIlviPD~~aNAGGVivS~~E~~qN~~~~~ws~eeV~~rL  586 (636)
                      ++|+||.+||++|..++||+|+||||+|+||||+++|++|||+|+||+++||||||+|||||+||+++++|++|+|++||
T Consensus       326 l~~~I~~~~a~~L~a~g~k~IaEgAN~p~t~eA~~iL~~rGIl~~PD~~aNAGGVi~S~~E~~qn~~~~~w~~eeV~~kL  405 (450)
T 4fcc_A          326 TQNELDVDAAHQLIANGVKAVAEGANMPTTIEATELFQQAGVLFAPGKAANAGGVATSGLEMAQNAARLGWKAEKVDARL  405 (450)
T ss_dssp             CTTCBCHHHHHHHHHTTCCEEECCSSSCBCHHHHHHHHHTTCEEECHHHHTTHHHHHHHHHHHHHHHTCCCCHHHHHHHH
T ss_pred             ccccccHHHHHHHHhcCceEEecCCCCCCCHHHHHHHHHCCCEEEChHHhcCccHhhhHHHHhhhcccCCCCHHHHHHHH
Confidence            99999999999998889999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHcCCCCCCCccHHHHHHHHHHHHHHHHHHhcCCC
Q 006655          587 QEAMKQTYQRALKAATDFGYQKESPEALVHGAVISSFLTIAQAMTDQGCV  636 (636)
Q Consensus       587 ~~~m~~~~~~v~~~A~~~~~~~~~~~~~~~aA~i~a~~rVa~Am~~~G~~  636 (636)
                      +++|.++|+++++++++..     ..+|+.|||++||+|||+||++||+|
T Consensus       406 ~~im~~~~~~~~~~~~e~~-----~~~~~~aA~i~a~~rVa~Am~~~G~v  450 (450)
T 4fcc_A          406 HHIMLDIHHACVEHGGEGE-----QTNYVQGANIAGFVKVADAMLAQGVI  450 (450)
T ss_dssp             HHHHHHHHHHHHHTSCSSS-----SCCHHHHHHHHHHHHHHHHHHHTCCC
T ss_pred             HHHHHHHHHHHHHHHHhcC-----CCCHHHHHHHHHHHHHHHHHHhcCCC
Confidence            9999999999998876532     23899999999999999999999997



>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 636
d1bgva2194 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostr 7e-67
d1hwxa2208 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (B 7e-56
d1bgva1255 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clost 9e-54
d1b26a2175 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermo 2e-53
d1v9la2176 c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyroba 1e-52
d1gtma2178 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archae 2e-52
d1b26a1234 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Therm 7e-46
d1v9la1242 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrob 8e-45
d1gtma1239 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archa 6e-43
d1hwxa1293 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow ( 3e-40
d1leha2134 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus 3e-25
d1leha1230 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillu 1e-24
d1c1da2148 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rh 7e-24
d1c1da1201 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {R 7e-16
>d1bgva2 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Length = 194 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Aminoacid dehydrogenase-like, N-terminal domain
superfamily: Aminoacid dehydrogenase-like, N-terminal domain
family: Aminoacid dehydrogenases
domain: Glutamate dehydrogenase
species: Clostridium symbiosum [TaxId: 1512]
 Score =  215 bits (548), Expect = 7e-67
 Identities = 104/194 (53%), Positives = 143/194 (73%), Gaps = 3/194 (1%)

Query: 190 SKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHY--VNIMERLLEPERMIVF 247
           SK    ++    K+   E EF+Q+V+E L +L  V+  +  Y  V ++ER++ PER+I F
Sbjct: 1   SKYVDRVIAEVEKKYADEPEFVQTVEEVLSSLGPVVDAHPEYEEVALLERMVIPERVIEF 60

Query: 248 RVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYK 307
           RVPW DD G+ HVN G+RVQF+ A+GP +GGLRF PS+NLSI KFLGFEQ  K++L+   
Sbjct: 61  RVPWEDDNGKVHVNTGYRVQFNGAIGPYKGGLRFAPSVNLSIMKFLGFEQAFKDSLTTLP 120

Query: 308 LGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQY 367
           +GGA GGSDFDP GKSD E+MRFCQ+FM E++R++GPD D+P+ ++GVG RE+GY++GQY
Sbjct: 121 MGGAKGGSDFDPNGKSDREVMRFCQAFMTELYRHIGPDIDVPAGDLGVGAREIGYMYGQY 180

Query: 368 RRLAGHFQ-GSFTG 380
           R++ G F  G  TG
Sbjct: 181 RKIVGGFYNGVLTG 194


>d1hwxa2 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Length = 208 Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Length = 255 Back     information, alignment and structure
>d1b26a2 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 175 Back     information, alignment and structure
>d1v9la2 c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Length = 176 Back     information, alignment and structure
>d1gtma2 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 178 Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Length = 242 Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 239 Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Length = 293 Back     information, alignment and structure
>d1leha2 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Length = 134 Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Length = 230 Back     information, alignment and structure
>d1c1da2 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 148 Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 201 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query636
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 100.0
d1bgva2194 Glutamate dehydrogenase {Clostridium symbiosum [Ta 100.0
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 100.0
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 100.0
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 100.0
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 100.0
d1hwxa2208 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 100.0
d1b26a2175 Glutamate dehydrogenase {Thermotoga maritima [TaxI 100.0
d1gtma2178 Glutamate dehydrogenase {Archaeon Pyrococcus furio 100.0
d1v9la2176 Glutamate dehydrogenase {Pyrobaculum islandicum [T 100.0
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 100.0
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 100.0
d1c1da2148 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 100.0
d1leha2134 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 99.98
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 97.76
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 97.5
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.29
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 97.24
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 97.04
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.77
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.64
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.6
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.3
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.27
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.25
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 96.23
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 96.23
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.15
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 96.12
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 96.02
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 96.02
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.97
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 95.93
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.93
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 95.92
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.87
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.76
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 95.62
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.59
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.56
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.46
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 95.43
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 95.41
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 95.39
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.37
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 95.23
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 95.1
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.03
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 95.03
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 95.0
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.91
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 94.89
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.89
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 94.76
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 94.74
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 94.73
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 94.7
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 94.63
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 94.57
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 94.56
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 94.53
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 94.5
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 94.5
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.39
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.36
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 94.33
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 94.28
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.28
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 94.22
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 94.21
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.05
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 93.83
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.77
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 93.74
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 93.66
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 93.63
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 93.47
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.36
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 93.17
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 92.98
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 92.97
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 92.9
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 92.88
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 92.77
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 92.7
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 92.41
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 92.39
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 92.27
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 91.98
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 91.85
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 91.82
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 91.74
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.7
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 91.64
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 91.63
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 91.51
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 91.34
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 91.16
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 91.15
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 90.85
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 90.79
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 90.38
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 90.35
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 90.25
d1gq2a1298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 89.68
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 89.67
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 89.66
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 89.5
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 89.47
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 89.42
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 89.11
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 89.08
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 89.06
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 89.01
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 88.93
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 88.86
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 88.85
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 88.77
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 88.44
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 88.36
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 88.33
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 88.29
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 88.22
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 88.17
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 88.05
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 87.82
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 87.79
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 87.73
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 87.7
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 87.32
d1pj3a1294 Mitochondrial NAD(P)-dependent malic enzyme {Human 87.26
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 87.19
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 87.15
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 87.14
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 86.97
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 86.94
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 86.75
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 86.67
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 86.62
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 86.52
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 86.38
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 86.22
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 86.22
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 86.14
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 85.97
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 85.62
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 85.13
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 85.1
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 85.03
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 84.94
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 84.94
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 84.82
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 84.74
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 84.64
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 84.53
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 84.49
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 84.49
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 84.36
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 84.27
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 84.23
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 84.19
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 84.16
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 84.1
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 84.07
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 84.06
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 84.0
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 83.73
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 83.69
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 83.67
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 83.61
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 83.52
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 83.52
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 83.49
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 82.94
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 82.7
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 82.69
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 82.67
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 82.57
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 82.48
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 82.43
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 82.39
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 82.32
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 82.23
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 81.58
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 81.37
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 81.29
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 81.07
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 81.05
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 81.02
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 80.87
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 80.44
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 80.38
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 80.24
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 80.21
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 80.13
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 80.09
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 80.04
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Aminoacid dehydrogenase-like, C-terminal domain
domain: Glutamate dehydrogenase
species: Clostridium symbiosum [TaxId: 1512]
Probab=100.00  E-value=1.7e-69  Score=549.26  Aligned_cols=251  Identities=31%  Similarity=0.580  Sum_probs=231.2

Q ss_pred             cccccCCCCCCCCcchhHHHHHHHHHHHHhCCCCCCcEEEEecCccHHHHHHHHHHHCCCEEEEEeCCCCceeCCCCCCH
Q 006655          381 PRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDY  460 (636)
Q Consensus       381 Kp~~~GGs~~r~eATG~GV~~~~~~~l~~~g~~l~GkrVaIqGfGNVG~~aAe~L~e~GAkVVaVSDs~G~IydpdGLDv  460 (636)
                      ||+++|||.+|++||||||++++++++++++.+|+|+||+||||||||+++|++|++.|+|||+|||++|+||||+|||+
T Consensus         1 Kp~~~GGs~gR~eATG~Gv~~~~~~~~~~~~~~l~g~~v~IQGfGnVG~~~a~~L~e~GakvvavsD~~G~i~~~~Gld~   80 (255)
T d1bgva1           1 KARSFGGSLVRPEATGYGSVYYVEAVMKHENDTLVGKTVALAGFGNVAWGAAKKLAELGAKAVTLSGPDGYIYDPEGITT   80 (255)
T ss_dssp             CCGGGTCCTTTTTHHHHHHHHHHHHHHHHTTCCSTTCEEEECCSSHHHHHHHHHHHHHTCEEEEEEETTEEEECTTCSCS
T ss_pred             CCccccCCCCCCccchHHHHHHHHHHHHhCCCCCCCCEEEEECCCHHHHHHHHHHHHcCCeEEEEecCCceEecCCCCCH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHH-HHHh-hcCCccccccccCCceeeCCCCccccccceEecCCCcCccchhhHHHhhhcCceEEEeCCCCCCCHH
Q 006655          461 MKISFLR-DIKS-QQRSLRDYSKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPE  538 (636)
Q Consensus       461 e~L~~L~-~~k~-~~g~l~~y~~~~p~a~~i~~~eil~~~cDIliPcA~~n~It~enA~~l~~~~akiVvEgAN~P~T~e  538 (636)
                      ++|..+. +.+. .++++.+|... .+.++++++++|+.+||||+|||++|+||.+||++|..++||+|+||||+|+|++
T Consensus        81 ~~l~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~DiliPcA~~~~I~~~~a~~l~a~~ck~I~EgAN~p~t~e  159 (255)
T d1bgva1          81 EEKINYMLEMRASGRNKVQDYADK-FGVQFFPGEKPWGQKVDIIMPCATQNDVDLEQAKKIVANNVKYYIEVANMPTTNE  159 (255)
T ss_dssp             HHHHHHHHHHHHHCCCCTHHHHHH-HTCEEEETCCGGGSCCSEEECCSCTTCBCHHHHHHHHHTTCCEEECCSSSCBCHH
T ss_pred             HHHHHHHHHHhhhcCcchhhhhhh-cCceeechhhcccccccEEeeccccccccHHHHHhhhhcCceEEecCCCCCcchH
Confidence            8864332 2222 23556666433 3678899999999999999999999999999999998889999999999999999


Q ss_pred             HHHH-HHHCCceEecccccccccceeecchhccccCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCccHHHH
Q 006655          539 AVDV-LKKANVLIAPAMAAGAGGVVAGELELNQECNMVHWSPEDFESKLQEAMKQTYQRALKAATDFGYQKESPEALVHG  617 (636)
Q Consensus       539 A~~i-L~~rGIlviPD~~aNAGGVivS~~E~~qN~~~~~ws~eeV~~rL~~~m~~~~~~v~~~A~~~~~~~~~~~~~~~a  617 (636)
                      |+++ |++|||+|+||+++|||||++|||||+||+++++|++++|+++|+++|.++|++++++|++++++    .+||+|
T Consensus       160 a~~~ll~~~gI~vvPD~laNaGGVivSy~E~~qn~~~~~w~~~ev~~~l~~~m~~~~~~v~~~a~~~~~~----~~lr~a  235 (255)
T d1bgva1         160 ALRFLMQQPNMVVAPSKAVNAGGVLVSGFEMSQNSERLSWTAEEVDSKLHQVMTDIHDGSAAAAERYGLG----YNLVAG  235 (255)
T ss_dssp             HHHHHHHCTTCEEECHHHHTTHHHHHHHHHHHHHHHTSCCCHHHHHHHHHHHHHHHHHHHHHHHHHTTCC----SCHHHH
T ss_pred             HHHHHHHhcCCEEehHhhhcCCceeeehhhhhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHhCCC----CCHHHH
Confidence            9876 56689999999999999999999999999999999999999999999999999999999999983    489999


Q ss_pred             HHHHHHHHHHHHHHhcCCC
Q 006655          618 AVISSFLTIAQAMTDQGCV  636 (636)
Q Consensus       618 A~i~a~~rVa~Am~~~G~~  636 (636)
                      ||++||+||++||..||+.
T Consensus       236 A~~~a~~Rva~A~~~rG~~  254 (255)
T d1bgva1         236 ANIVGFQKIADAMMAQGIA  254 (255)
T ss_dssp             HHHHHHHHHHHHHHHHCSC
T ss_pred             HHHHHHHHHHHHHHHcCCc
Confidence            9999999999999999984



>d1bgva2 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hwxa2 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b26a2 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gtma2 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v9la2 c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1c1da2 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1leha2 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure