Citrus Sinensis ID: 006696


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-----
MKFSSAAPLFFPLCVIVSLLPLAFADLNSDRQALLDFADAVPHLRKLNWSSTNPICQSWVGINCTQDRTRVFGLRLPGIGLVGPIPNNTLGKLDALEVLSLRSNVLTGGLPSEITSLPSLRYLYLQHNNFSGKIPSSFSPQLVVLDLSFNSFTGNIPQSIQNLTQLTGLSLQSNNLSGSIPNFDIPKLRHLNLSYNGLKGSIPSSLQKFPNSSFVGNSLLCGPPLKACFPVAPSPSPTYSPPPFIPRKQSSKQKLGLGAIIAIAVGGSAVLLLVALVILCYCLKKKDNGSNGVSKGKASSGGRSEKPKEEFGSGVQEPEKNKLVFFEGCSYNFDLEDLLRASAEVLGKGSYGTAYKAVLEESTTVVVKRLKEVVVGKRDFEQQMEIVGRVGQHPNVVPLRAYYYSKDEKLLVYDYFASGSLSTLLHGNRGAGRTPLDWETRVKILLGTARGVAHIHSMGGPKFTHGNIKASNVLINQDLDGCISDFGLTPLMNVPATPSRSAGYRAPEVIETRKHSHKSDVYSFGVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQMLQIGMACVAKVPDMRPNMDEVVRMIEEVRQSDSENRPSSEENKSKDSNVQTP
cccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccccccccEEEECccccEEEEEEccccccccccccccccccccccEEEccccccccccccccccccccccEEcccccccccccccccccccEEEcccccccccccHHHHcccccccEEcccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHcccccccccccEEEEEEccccEEEEEEcccccccHHHHHHHHHHHHcccccccccccEEEEEcccCEEEEEcccccccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEcccccCEEcccccccccccccccccccccccccccccccccccccEEHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccEEEccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccccccccccccccccc
****SAAPLFFPLCVIVSLLPLAFADLNSDRQALLDFADAVPHLRKLNWSSTNPICQSWVGINCTQDRTRVFGLRLPGIGLVGPIPNNTLGKLDALEVLSLRSNVLTGGLPSEITSLPSLRYLYLQHNNFSGKIPSSFSPQLVVLDLSFNSFTGNIPQSIQNLTQLTGLSLQSNNLSGSIPNFDIPKLRHLNLSYNGLKGSIPSSLQKFPNSSFVGNSLLCGPPLKACF*************************LGLGAIIAIAVGGSAVLLLVALVILCYCLKK************************************KLVFFEGCSYNFDLEDLLRASAEVLGKGSYGTAYKAVLEESTTVVVKRLKEVVVGKRDFEQQMEIVGRVGQHPNVVPLRAYYYSKDEKLLVYDYFASGSLSTLLHGNRGAGRTPLDWETRVKILLGTARGVAHIHSMGGPKFTHGNIKASNVLINQDLDGCISDFGLTPLMNVPATPSRSAGYRAPEVIETRKHSHKSDVYSFGVLLLEMLTGKAPLQ***RDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQMLQIGMACVAKVPDMRPNMDEVVRM****************************
xxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKFSSAAPLFFPLCVIVSLLPLAFADLNSDRQALLDFADAVPHLRKLNWSSTNPICQSWVGINCTQDRTRVFGLRLPGIGLVGPIPNNTLGKLDALEVLSLRSNVLTGGLPSEITSLPSLRYLYLQHNNFSGKIPSSFSPQLVVLDLSFNSFTGNIPQSIQNLTQLTGLSLQSNNLSGSIPNFDIPKLRHLNLSYNGLKGSIPSSLQKFPNSSFVGNSLLCGPPLKACFPVAPSPSPTYSPPPFIPRKQSSKQKLGLGAIIAIAVGGSAVLLLVALVILCYCLKKKDNGSNGVSKGKASSGGRSEKPKEEFGSGVQEPEKNKLVFFEGCSYNFDLEDLLRASAEVLGKGSYGTAYKAVLEESTTVVVKRLKEVVVGKRDFEQQMEIVGRVGQHPNVVPLRAYYYSKDEKLLVYDYFASGSLSTLLHGNRGAGRTPLDWETRVKILLGTARGVAHIHSMGGPKFTHGNIKASNVLINQDLDGCISDFGLTPLMNVPATPSRSAGYRAPEVIETRKHSHKSDVYSFGVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQMLQIGMACVAKVPDMRPNMDEVVRMIEEVRQSDSENRPSSEENKSKDSNVQTP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable inactive receptor kinase At5g58300 confidentQ9LVM0

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T6Q, chain A
Confidence level:very confident
Coverage over the Query: 69-215
View the alignment between query and template
View the model in PyMOL
Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 26-214
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 332-611
View the alignment between query and template
View the model in PyMOL
Template: 3MTL, chain A
Confidence level:very confident
Coverage over the Query: 343-634
View the alignment between query and template
View the model in PyMOL
Template: 3TL8, chain A
Confidence level:confident
Coverage over the Query: 329-621
View the alignment between query and template
View the model in PyMOL
Template: 2K1K, chain A
Confidence level:probable
Coverage over the Query: 254-285
View the alignment between query and template
View the model in PyMOL