BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 006705
(634 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1KCF|A Chain A, Crystal Structure Of The Yeast Mitochondrial Holliday
Junction Resolvase, Ydc2
pdb|1KCF|B Chain B, Crystal Structure Of The Yeast Mitochondrial Holliday
Junction Resolvase, Ydc2
Length = 258
Score = 31.6 bits (70), Expect = 1.6, Method: Compositional matrix adjust.
Identities = 16/42 (38%), Positives = 21/42 (50%)
Query: 404 CVVDMLGRAGRVGEALEFIKNMPFEPTAAILGSLLGACRVHY 445
C + L R+GR E L I + P PT+ +LG LG Y
Sbjct: 13 CKLTGLSRSGRKDELLRRIVDSPIYPTSRVLGIDLGIKNFSY 54
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.136 0.407
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 18,597,403
Number of Sequences: 62578
Number of extensions: 755609
Number of successful extensions: 1839
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 1838
Number of HSP's gapped (non-prelim): 5
length of query: 634
length of database: 14,973,337
effective HSP length: 105
effective length of query: 529
effective length of database: 8,402,647
effective search space: 4445000263
effective search space used: 4445000263
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)