Citrus Sinensis ID: 006727

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630---
MTKIYLLALVVVYNFCFSAGISMNGVSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFLGMVEALTLLENETVAIIGPQFSVIAHLVSHIANEFQVPLLSFAATDPSLSSLQYPFFVRTTQSDLYQMAAIADIVDYFGWRNVIALYVDDDHGRNGIAALGDKLAEKRCRLSHKVPLSPKGSRNQIIDTLLTVSSMMSRILILHTYDIWGLEVLNAAKHLRMMESGYVWIVTDWLSSILDTDSQLHSEKMDDIQGVLTLRMYTQSSEEKRKFVTRWRHLTRRNTLNGPIGLNSFGLYAYDTLWLLAHAIGAFFDQGGNISFSEDSKLSELSRGDMRFSSVSIFNGGKMLLDNILQVNMTGVTGPIKFTSDRDLINPAYEVINVIGTGSRRIGYWSNHSGLSVVPPEALYKEPSNRSASSQHLYSAVWPGQTTQKPRGWVFPNNGRHLRIGVPSQVIYPEFVAQGKGTDKFSGYCIDVFTAVLELLPYAVPYKLVPFGDGHNSPKRFDLLRLVSEEVYDAAVGDFAITTERTKMVDFTQPYIESGLVVVAPIKKLNSNAWAFLNPFTPKMWCVTGIFFLVVGVVVWILEHRLNDDFRGPPRRQIGTILW
cHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEccccccHHHHHHHHHHHHHHHHcccccccccEEEEEEEEccccHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHccccccEEEEEcccccccccccccEEEEcccHHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHcccccEEEEEEEccHHHHHHHHHHHHHccccccEEEEEEcccccccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHcEEEEccccEEEccccccccccEEEEEcccccEEEEEEEcccccccccccccccccccccccccccccccccccccEEccccEEccccccccEEccccccccccEEEEccccccEEEEEHHHHHHHHHHccccccEEEEEcccccccccHHHHHHHHHHccccEEEEcEEEEccccccccccccccccccEEEEEcccccccccEEEccccHHHHHHHHHHHHHHHEEEEEEEccccccccccccccEEEEcc
ccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEccccHHHHHHHHHHHHHHHHccccccccccEEEEEEEcccccHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHcccccEEEEcccccccccccccEEEEccccHHHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHccccccEEEEEEccHHHHcccccccccHHHHHHccEEEEEEcccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEccccccccccccccccccccccccHHHHHHHHHHccEccccEEEEEccccccccccEEEEEEcccccEEEEEEcccccEEEEcccHccccccccccccccccEEEEccccccccccEEEcccccEEEEEccccccHHHHEEcccccccEEEEHHHHHHHHHHHccccccEEEEEcccccccccHHHHHHHHHHccccEEEEEEEEEEEcEEEEEcccccHcccEEEEEEcccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccccEEEEEEc
MTKIYLLALVVVYNFCFSagismngvstippvlnigAVFALNSTIGKVAKVAIEAAVEdvnsnpailggtklkltvhdtnYSRFLGMVEALTLlenetvaiigPQFSVIAHLVSHIANefqvpllsfaatdpslsslqypffvrttQSDLYQMAAIADIVDYFGWRNVIALYvdddhgrngIAALGDKLAEKRcrlshkvplspkgsrnqIIDTLLTVSSMMSRILILHTYDIWGLEVLNAAKHLRMMESGYVWIVTDWLSSILDTDSQLHSEKMDDIQGVLTLRMYTQSSEEKRKFVTRWRHLTrrntlngpiglnsfglyAYDTLWLLAHAIGAffdqggnisfsedsklselsrgdmrfssvsifnggkMLLDNILQvnmtgvtgpikftsdrdlinpaYEVINVIgtgsrrigywsnhsglsvvppealykepsnrsassqhlysavwpgqttqkprgwvfpnngrhlrigvpsqviypefvaqgkgtdkfsgyCIDVFTAVLELlpyavpyklvpfgdghnspkrfDLLRLVSEEvydaavgdfaittertkmvdftqpyiesglVVVAPIKklnsnawaflnpftpkmwcvTGIFFLVVGVVVWILEHrlnddfrgpprrqigtilw
MTKIYLLALVVVYNFCFSAGISMNGVSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEdvnsnpailggtklkltVHDTNYSRFLGMVEALTLLENETVAIIGPQFSVIAHLVSHIANEFQVPLLSFAATDPSLSSLQYPFFVRTTQSDLYQMAAIADIVDYFGWRNVIALYVDDDHGRNGIAALGDKLAEKRCRLShkvplspkgsrnqiIDTLLTVSSMMSRILILHTYDIWGLEVLNAAKHLRMMESGYVWIVTDWLSSILDTDSQLHSEKMDDIQGVLTLRMytqsseekrkfvtrwrhltrrntlngpiglNSFGLYAYDTLWLLAHAIGAFFDQGGNISFSEDSKLSELSRGDMRFSSVSIFNGGKMLLDNILQVNMTGVTGPIkftsdrdlinpAYEVINVIGTGSRRIGYWSNHSGLSVVPPEALYKEPSNRSASSQHLYSAVWPGQTTQKPRGWVFPNNGRHLRIGVPSQVIYPEFVAQGKGTDKFSGYCIDVFTAVLELLPYAVPYKLVPFGDGHNSPKRFDLLRLVSEEVYDAAVGDFAITTERTKMVDFTQPYIESGLVVVAPIKKLNSNAWAFLNPFTPKMWCVTGIFFLVVGVVVWILEhrlnddfrgpprrqigtilw
MTKIYLLALVVVYNFCFSAGISMNGVSTIPPVLNIGAVFALNSTIGkvakvaieaavedvNSNPAILGGTKLKLTVHDTNYSRFLGMVEALTLLENETVAIIGPQFSVIAHLVSHIANEFQVPLLSFAATDPSLSSLQYPFFVRTTQSDLYQMAAIADIVDYFGWRNVIALYVDDDHGRNGIAALGDKLAEKRCRLSHKVPLSPKGSRNQIIDTLLTVSSMMSRILILHTYDIWGLEVLNAAKHLRMMESGYVWIVTDWLSSILDTDSQLHSEKMDDIQGVLTLRMYTQSSEEKRKFVTRWRHLTRRNTLNGPIGLNSFGLYAYDTLWLLAHAIGAFFDQGGNISFSEDSKLSELSRGDMRFSSVSIFNGGKMLLDNILQVNMTGVTGPIKFTSDRDLINPAYEVINVIGTGSRRIGYWSNHSGLSVVPPEALYKEPSNRSASSQHLYSAVWPGQTTQKPRGWVFPNNGRHLRIGVPSQVIYPEFVAQGKGTDKFSGYCIDVFTAVLELLPYAVPYKLVPFGDGHNSPKRFDLLRLVSEEVYDAAVGDFAITTERTKMVDFTQPYIESGLVVVAPIKKLNSNAWAFLNPFTPKMWCVTGIFFLVVGVVVWILEHRLNDDFRGPPRRQIGTILW
**KIYLLALVVVYNFCFSAGISMNGVSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFLGMVEALTLLENETVAIIGPQFSVIAHLVSHIANEFQVPLLSFAATDPSLSSLQYPFFVRTTQSDLYQMAAIADIVDYFGWRNVIALYVDDDHGRNGIAALGDKLAEKRCRLSH**********NQIIDTLLTVSSMMSRILILHTYDIWGLEVLNAAKHLRMMESGYVWIVTDWLSSILDTDSQLH**KMDDIQGVLTLRMYTQ****KRKFVTRWRHLTRRNTLNGPIGLNSFGLYAYDTLWLLAHAIGAFFDQGGNISF**************RFSSVSIFNGGKMLLDNILQVNMTGVTGPIKFTSDRDLINPAYEVINVIGTGSRRIGYWSNHSGLSVV******************LYSAVWPGQTTQKPRGWVFPNNGRHLRIGVPSQVIYPEFVAQGKGTDKFSGYCIDVFTAVLELLPYAVPYKLVPFGDGHNSPKRFDLLRLVSEEVYDAAVGDFAITTERTKMVDFTQPYIESGLVVVAPIKKLNSNAWAFLNPFTPKMWCVTGIFFLVVGVVVWILEHRLNDDF*************
*TKIYLLALVVVYNFCFSAGI******TIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFLGMVEALTLLENETVAIIGPQFSVIAHLVSHIANEFQVPLLSFAATDPSLSSLQYPFFVRTTQSDLYQMAAIADIVDYFGWRNVIALYVDDDHGRNGIAALGDKLAEKRCRLSHKV*L*******QIIDTLLTVSSMMSRILILHTYDIWGLEVLNAAKHLRMMESGYVWIVTDWLSSILDTDSQLHSEKMDDIQGVLTLRMYTQSSEEKRKFVTRWRHLTRRNTLNGPIGLNSFGLYAYDTLWLLAHAIGAFFDQGGNISFSEDSKLSELSRG*MRFSSVSIFNGGKMLLDNILQVNMTGVTGPIKFTSDRDLINPAYEVINVIGTGSRRIGYWSNHSGLSVVPPEALY***********HLYSAVWPGQTTQKPRGWVFPNNGRHLRIGVPSQVIYPEFVAQGKGTDKFSGYCIDVFTAVLELLPYAVPYKLVPFGDGHNSPKRFDLLRLVSEEVYDAAVGDFAITTERTKMVDFTQPYIESGLVVVAPIKKLNSNAWAFLNPFTPKMWCVTGIFFLVVGVVVWILEHRLNDDFRGPPRRQIGTILW
MTKIYLLALVVVYNFCFSAGISMNGVSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFLGMVEALTLLENETVAIIGPQFSVIAHLVSHIANEFQVPLLSFAATDPSLSSLQYPFFVRTTQSDLYQMAAIADIVDYFGWRNVIALYVDDDHGRNGIAALGDKLAEKRCRLSHKVPLSPKGSRNQIIDTLLTVSSMMSRILILHTYDIWGLEVLNAAKHLRMMESGYVWIVTDWLSSILDTDSQLHSEKMDDIQGVLTLRMYTQSSEEKRKFVTRWRHLTRRNTLNGPIGLNSFGLYAYDTLWLLAHAIGAFFDQGGNISFSEDSKLSELSRGDMRFSSVSIFNGGKMLLDNILQVNMTGVTGPIKFTSDRDLINPAYEVINVIGTGSRRIGYWSNHSGLSVVPPEAL**************YSAVWPGQTTQKPRGWVFPNNGRHLRIGVPSQVIYPEFVAQGKGTDKFSGYCIDVFTAVLELLPYAVPYKLVPFGDGHNSPKRFDLLRLVSEEVYDAAVGDFAITTERTKMVDFTQPYIESGLVVVAPIKKLNSNAWAFLNPFTPKMWCVTGIFFLVVGVVVWILEHRLNDDFRGPPRRQIGTILW
*TKIYLLALVVVYNFCFSAGISMNGVSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFLGMVEALTLLENETVAIIGPQFSVIAHLVSHIANEFQVPLLSFAATDPSLSSLQYPFFVRTTQSDLYQMAAIADIVDYFGWRNVIALYVDDDHGRNGIAALGDKLAEKRCRLSHKVPLSPKGSRNQIIDTLLTVSSMMSRILILHTYDIWGLEVLNAAKHLRMMESGYVWIVTDWLSSILDTDSQLHSEKMDDIQGVLTLRMYTQSSEEKRKFVTRWRHLTRRNTLNGPIGLNSFGLYAYDTLWLLAHAIGAFFDQGGNISFSEDSKLSELSRGDMRFSSVSIFNGGKMLLDNILQVNMTGVTGPIKFTSDRDLINPAYEVINVIGTGSRRIGYWSNHSGLSVVPPEALYK*PSNRSASSQHLYSAVWPGQTTQKPRGWVFPNNGRHLRIGVPSQVIYPEFVAQGKGTDKFSGYCIDVFTAVLELLPYAVPYKLVPFGDGHNSPKRFDLLRLVSEEVYDAAVGDFAITTERTKMVDFTQPYIESGLVVVAPIKKLNSNAWAFLNPFTPKMWCVTGIFFLVVGVVVWILEHRLNDDFRGPPRRQIGTILW
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKIYLLALVVVYNFCFSAGISMNGVSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFLGMVEALTLLENETVAIIGPQFSVIAHLVSHIANEFQVPLLSFAATDPSLSSLQYPFFVRTTQSDLYQMAAIADIVDYFGWRNVIALYVDDDHGRNGIAALGDKLAEKRCRLSHKVPLSPKGSRNQIIDTLLTVSSMMSRILILHTYDIWGLEVLNAAKHLRMMESGYVWIVTDWLSSILDTDSQLHSEKMDDIQGVLTLRMYTQSSEEKRKFVTRWRHLTRRNTLNGPIGLNSFGLYAYDTLWLLAHAIGAFFDQGGNISFSEDSKLSELSRGDMRFSSVSIFNGGKMLLDNILQVNMTGVTGPIKFTSDRDLINPAYEVINVIGTGSRRIGYWSNHSGLSVVPPEALYKEPSNRSASSQHLYSAVWPGQTTQKPRGWVFPNNGRHLRIGVPSQVIYPEFVAQGKGTDKFSGYCIDVFTAVLELLPYAVPYKLVPFGDGHNSPKRFDLLRLVSEEVYDAAVGDFAITTERTKMVDFTQPYIESGLVVVAPIKKLNSNAWAFLNPFTPKMWCVTGIFFLVVGVVVWILEHRLNDDFRGPPRRQIGTILW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query633 2.2.26 [Sep-21-2011]
Q84W41 903 Glutamate receptor 3.6 OS yes no 0.973 0.682 0.550 0.0
Q9C8E7 933 Glutamate receptor 3.3 OS no no 0.951 0.645 0.548 0.0
Q93YT1 912 Glutamate receptor 3.2 OS no no 0.955 0.663 0.525 0.0
Q7XP59 938 Glutamate receptor 3.1 OS yes no 0.976 0.658 0.514 0.0
Q8GXJ4 959 Glutamate receptor 3.4 OS no no 0.944 0.623 0.523 0.0
Q9SW97 953 Glutamate receptor 3.5 OS no no 0.949 0.630 0.514 0.0
Q7XJL2 921 Glutamate receptor 3.1 OS no no 0.949 0.652 0.513 0.0
Q9SDQ4 921 Glutamate receptor 3.7 OS no no 0.933 0.641 0.443 1e-149
Q8LGN0 952 Glutamate receptor 2.7 OS no no 0.913 0.607 0.330 2e-91
Q9SHV2 895 Glutamate receptor 2.3 OS no no 0.955 0.675 0.329 2e-90
>sp|Q84W41|GLR36_ARATH Glutamate receptor 3.6 OS=Arabidopsis thaliana GN=GLR3.6 PE=2 SV=1 Back     alignment and function desciption
 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/629 (55%), Positives = 476/629 (75%), Gaps = 13/629 (2%)

Query: 5   YLLALVVVYNFCFSAGISMNGVSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNP 64
           + L ++++ N     G++   VS  P V+NIG+VF  NS IGKV KVA++AAVEDVN++P
Sbjct: 3   WFLLMLIICNAVPLQGLT-KIVSARPQVVNIGSVFTFNSLIGKVIKVAMDAAVEDVNASP 61

Query: 65  AILGGTKLKLTVHDTNYSRFLGMVEALTLLENETVAIIGPQFSVIAHLVSHIANEFQVPL 124
           +IL  T L++ +HDT Y+ F+ ++E L  +E+ETVAIIGPQ S  A +V+H+A E ++P+
Sbjct: 62  SILNTTTLRIIMHDTKYNGFMSIMEPLQFMESETVAIIGPQRSTTARVVAHVATELKIPI 121

Query: 125 LSFAATDPSLSSLQYPFFVRTTQSDLYQMAAIADIVDYFGWRNVIALYVDDDHGRNGIAA 184
           LSF+ATDP++S LQ+PFF+RT+Q+DL+QMAAIADIV ++GWR V+A+Y DDD+GRNG+AA
Sbjct: 122 LSFSATDPTMSPLQFPFFIRTSQNDLFQMAAIADIVQFYGWREVVAIYGDDDYGRNGVAA 181

Query: 185 LGDKLAEKRCRLSHKVPLSPKGSRNQIIDTLLTVSSMMSRILILHTYDIWGLEVLNAAKH 244
           LGD+L+EKRCR+S+K  L P  +R  I D L+ V+   SRI+++H   IWGLE+ N A++
Sbjct: 182 LGDRLSEKRCRISYKAALPPAPTRENITDLLIKVALSESRIIVVHASFIWGLELFNVARN 241

Query: 245 LRMMESGYVWIVTDWLSSILDTDSQLHSEKMDDIQGVLTLRMYTQSSEEKRKFVTRWRHL 304
           L MM +GYVWI T+WLS+I+DTDS L  + +++IQGV+TLR++T +S  K+ FV RW +L
Sbjct: 242 LGMMSTGYVWIATNWLSTIIDTDSPLPLDTINNIQGVITLRLHTPNSIMKQNFVQRWHNL 301

Query: 305 TRRNTLNGPIGLNSFGLYAYDTLWLLAHAIGAFFDQGGNISFSEDSKLSELSRGDMRFSS 364
           T        +GL+++ LYAYDT+WLLA AI  FF +GGN+SFS++  +SEL  G++   +
Sbjct: 302 TH-------VGLSTYALYAYDTVWLLAQAIDDFFKKGGNVSFSKNPIISELGGGNLHLDA 354

Query: 365 VSIFNGGKMLLDNILQVNMTGVTGPIKFTSDRDLINPAYEVINVIGTGSRRIGYWSNHSG 424
           + +F+GGK+ L++ILQV+  G+TG +KFTSDR+L+NPA++V+NVIGTG   IGYW NHSG
Sbjct: 355 LKVFDGGKIFLESILQVDRIGLTGRMKFTSDRNLVNPAFDVLNVIGTGYTTIGYWFNHSG 414

Query: 425 LSVVPPEALYKEPSNRSASSQHLYSAVWPGQTTQKPRGWVFPNNGRHLRIGVPSQVIYPE 484
           LSV+P +    E  N S S Q L+S VWPG + + PRGWVF NNGRHLRIGVP++  + E
Sbjct: 415 LSVMPAD----EMENTSFSGQKLHSVVWPGHSIKIPRGWVFSNNGRHLRIGVPNRYRFEE 470

Query: 485 FVAQGKGTDKFSGYCIDVFTAVLELLPYAVPYKLVPFGDGHNSPKRFDLLRLVSEEVYDA 544
            V+  K     +G+C+DVF A + LLPYAVP++LV FG+GH++P   +L+RL++  VYDA
Sbjct: 471 VVSV-KSNGMITGFCVDVFIAAINLLPYAVPFELVAFGNGHDNPSNSELVRLITTGVYDA 529

Query: 545 AVGDFAITTERTKMVDFTQPYIESGLVVVAPIKKLNSNAWAFLNPFTPKMWCVTGIFFLV 604
            VGD  I TERTKM DFTQPY+ESGLVVVAP++KL S+A AFL PFTP+MW +    FL+
Sbjct: 530 GVGDITIITERTKMADFTQPYVESGLVVVAPVRKLGSSAMAFLRPFTPQMWLIAAASFLI 589

Query: 605 VGVVVWILEHRLNDDFRGPPRRQIGTILW 633
           VG V+W LEH+ ND+FRGPPRRQ+ T  W
Sbjct: 590 VGAVIWCLEHKHNDEFRGPPRRQVITTFW 618
Glutamate-gated receptor that probably acts as non-selective cation channel. May be involved in light-signal transduction and calcium homeostasis via the regulation of calcium influx into cells.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9C8E7|GLR33_ARATH Glutamate receptor 3.3 OS=Arabidopsis thaliana GN=GLR3.3 PE=2 SV=1 Back     alignment and function description
>sp|Q93YT1|GLR32_ARATH Glutamate receptor 3.2 OS=Arabidopsis thaliana GN=GLR3.2 PE=1 SV=2 Back     alignment and function description
>sp|Q7XP59|GLR31_ORYSJ Glutamate receptor 3.1 OS=Oryza sativa subsp. japonica GN=GLR3.1 PE=1 SV=1 Back     alignment and function description
>sp|Q8GXJ4|GLR34_ARATH Glutamate receptor 3.4 OS=Arabidopsis thaliana GN=GLR3.4 PE=2 SV=2 Back     alignment and function description
>sp|Q9SW97|GLR35_ARATH Glutamate receptor 3.5 OS=Arabidopsis thaliana GN=GLR3.5 PE=2 SV=2 Back     alignment and function description
>sp|Q7XJL2|GLR31_ARATH Glutamate receptor 3.1 OS=Arabidopsis thaliana GN=GLR3.1 PE=2 SV=2 Back     alignment and function description
>sp|Q9SDQ4|GLR37_ARATH Glutamate receptor 3.7 OS=Arabidopsis thaliana GN=GLR3.7 PE=2 SV=2 Back     alignment and function description
>sp|Q8LGN0|GLR27_ARATH Glutamate receptor 2.7 OS=Arabidopsis thaliana GN=GLR2.7 PE=2 SV=3 Back     alignment and function description
>sp|Q9SHV2|GLR23_ARATH Glutamate receptor 2.3 OS=Arabidopsis thaliana GN=GLR2.3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query633
225438444 938 PREDICTED: glutamate receptor 3.6-like [ 0.998 0.673 0.666 0.0
296082561 936 unnamed protein product [Vitis vinifera] 0.993 0.672 0.668 0.0
255561451 769 glutamate receptor 3 plant, putative [Ri 0.976 0.803 0.647 0.0
224081501 937 glutamate-gated kainate-type ion channel 0.996 0.673 0.653 0.0
127519383 946 glutamate receptor [Malus hupehensis] 1.0 0.669 0.641 0.0
449491245 943 PREDICTED: glutamate receptor 3.6-like [ 0.998 0.670 0.622 0.0
449434080 932 PREDICTED: glutamate receptor 3.6-like [ 0.998 0.678 0.622 0.0
224081497 928 glutamate-gated kainate-type ion channel 0.993 0.677 0.650 0.0
357933583 958 glutamate receptor 3.5 [Solanum lycopers 0.998 0.659 0.612 0.0
356529661 938 PREDICTED: glutamate receptor 3.6-like [ 0.992 0.669 0.603 0.0
>gi|225438444|ref|XP_002276999.1| PREDICTED: glutamate receptor 3.6-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/633 (66%), Positives = 514/633 (81%), Gaps = 1/633 (0%)

Query: 1   MTKIYLLALVVVYNFCFSAGISMNGVSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDV 60
           M  ++ L L+V  N   S G+  N VS+ P V+NIGA+F+ NSTIGKVAK A+EAAV+DV
Sbjct: 1   MKMVWFLLLMVFLNGIISNGVGTN-VSSRPSVVNIGAIFSFNSTIGKVAKFALEAAVQDV 59

Query: 61  NSNPAILGGTKLKLTVHDTNYSRFLGMVEALTLLENETVAIIGPQFSVIAHLVSHIANEF 120
           NS+P +LGGTKLKL   DTN+S F  ++EAL  +E +TVAIIGPQ SV+AH+VSHIANE 
Sbjct: 60  NSDPTVLGGTKLKLRTQDTNFSGFGAIMEALQFMEGDTVAIIGPQSSVMAHVVSHIANEL 119

Query: 121 QVPLLSFAATDPSLSSLQYPFFVRTTQSDLYQMAAIADIVDYFGWRNVIALYVDDDHGRN 180
           QVPL+S+AATDP+L SLQYPFF+ TT SDLYQMAAIAD+VDY+GWR VIA+YVDDD+GRN
Sbjct: 120 QVPLISYAATDPTLFSLQYPFFLMTTHSDLYQMAAIADLVDYYGWREVIAIYVDDDYGRN 179

Query: 181 GIAALGDKLAEKRCRLSHKVPLSPKGSRNQIIDTLLTVSSMMSRILILHTYDIWGLEVLN 240
           GIAALGD+L +KRC++S+K P+ P+ SR+ I D L+ V+   SRIL++HTY  WGLEVL+
Sbjct: 180 GIAALGDELTKKRCKISYKAPMYPESSRDDITDVLVKVALTESRILVVHTYTEWGLEVLD 239

Query: 241 AAKHLRMMESGYVWIVTDWLSSILDTDSQLHSEKMDDIQGVLTLRMYTQSSEEKRKFVTR 300
            A++L M  SGYVWI T+WLS+++DTD+ L S  M++IQGVLTLRMYT +SE K  FV+R
Sbjct: 240 VAQYLGMTGSGYVWIATNWLSTVMDTDASLPSNAMNNIQGVLTLRMYTPASELKSNFVSR 299

Query: 301 WRHLTRRNTLNGPIGLNSFGLYAYDTLWLLAHAIGAFFDQGGNISFSEDSKLSELSRGDM 360
           W +LT   T N  +GL+++GLYAYDT+W+LAHAI AFF+QGG+ISFS DS+L++L  G +
Sbjct: 300 WSNLTSAGTTNRHVGLSAYGLYAYDTVWVLAHAINAFFNQGGSISFSNDSRLTKLRGGSL 359

Query: 361 RFSSVSIFNGGKMLLDNILQVNMTGVTGPIKFTSDRDLINPAYEVINVIGTGSRRIGYWS 420
              ++SIF+GG +LL +ILQVNMTGVTGPIKF SD  LI PAYEVINVIGTG RRIGYWS
Sbjct: 360 HLDAMSIFDGGNLLLQSILQVNMTGVTGPIKFNSDHSLIRPAYEVINVIGTGVRRIGYWS 419

Query: 421 NHSGLSVVPPEALYKEPSNRSASSQHLYSAVWPGQTTQKPRGWVFPNNGRHLRIGVPSQV 480
           N+SGLSVVPP  LY +P NR++++Q LY A+WPGQ  Q PRGWVFP+NGR L IGVP +V
Sbjct: 420 NYSGLSVVPPAMLYTKPPNRTSTNQRLYDAIWPGQAAQTPRGWVFPSNGRQLIIGVPDRV 479

Query: 481 IYPEFVAQGKGTDKFSGYCIDVFTAVLELLPYAVPYKLVPFGDGHNSPKRFDLLRLVSEE 540
            Y EF+++ KGTD F GYCIDVFTA L LLPYAVPYKLVPFGDG ++P   DL+RL++  
Sbjct: 480 SYREFISRVKGTDMFKGYCIDVFTAALSLLPYAVPYKLVPFGDGIHNPSCTDLVRLITTG 539

Query: 541 VYDAAVGDFAITTERTKMVDFTQPYIESGLVVVAPIKKLNSNAWAFLNPFTPKMWCVTGI 600
           VYDAA+GD AI T RT+MVDFTQPYIESGLVVVAPIK  NSNAWAFL PF+  MW VTG 
Sbjct: 540 VYDAAIGDIAIVTNRTRMVDFTQPYIESGLVVVAPIKTSNSNAWAFLKPFSKNMWIVTGT 599

Query: 601 FFLVVGVVVWILEHRLNDDFRGPPRRQIGTILW 633
           FFL+VG VVWILEHR+ND+FRGPPRRQ  TILW
Sbjct: 600 FFLLVGAVVWILEHRINDEFRGPPRRQFVTILW 632

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296082561|emb|CBI21566.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255561451|ref|XP_002521736.1| glutamate receptor 3 plant, putative [Ricinus communis] gi|223539127|gb|EEF40723.1| glutamate receptor 3 plant, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224081501|ref|XP_002306436.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi|222855885|gb|EEE93432.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|127519383|gb|ABO28526.1| glutamate receptor [Malus hupehensis] Back     alignment and taxonomy information
>gi|449491245|ref|XP_004158839.1| PREDICTED: glutamate receptor 3.6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449434080|ref|XP_004134824.1| PREDICTED: glutamate receptor 3.6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224081497|ref|XP_002306435.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi|222855884|gb|EEE93431.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357933583|dbj|BAL15058.1| glutamate receptor 3.5 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|356529661|ref|XP_003533407.1| PREDICTED: glutamate receptor 3.6-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query633
TAIR|locus:2081805 903 GLR3.6 "glutamate receptor 3.6 0.973 0.682 0.532 5.6e-187
TAIR|locus:2206095 933 GLR3.3 "glutamate receptor 3.3 0.962 0.652 0.532 5.7e-178
TAIR|locus:2122128 912 GLUR2 "glutamate receptor 2" [ 0.979 0.679 0.510 1.4e-176
TAIR|locus:2207165 959 GLR3.4 "AT1G05200" [Arabidopsi 0.969 0.640 0.506 8.2e-170
TAIR|locus:2062586 921 GLR5 "glutamate receptor 5" [A 0.933 0.641 0.427 1.8e-133
TAIR|locus:2047251 895 GLR2.3 "glutamate receptor 2.3 0.957 0.677 0.323 1e-86
TAIR|locus:2066107 952 GLR2.7 "glutamate receptor 2.7 0.856 0.569 0.342 6.9e-86
TAIR|locus:2047256 920 GLR2.2 "glutamate receptor 2.2 0.954 0.656 0.323 1e-84
TAIR|locus:2181196 901 GLR2.1 "glutamate receptor 2.1 0.846 0.594 0.334 1e-82
TAIR|locus:2066086 947 GLR2.8 "glutamate receptor 2.8 0.902 0.602 0.332 6.6e-81
TAIR|locus:2081805 GLR3.6 "glutamate receptor 3.6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1813 (643.3 bits), Expect = 5.6e-187, P = 5.6e-187
 Identities = 335/629 (53%), Positives = 463/629 (73%)

Query:     5 YLLALVVVYNFCFSAGISMNGVSTIPPVLNIGAVFALNSTIGXXXXXXXXXXXXXXNSNP 64
             + L ++++ N     G++   VS  P V+NIG+VF  NS IG              N++P
Sbjct:     3 WFLLMLIICNAVPLQGLTKI-VSARPQVVNIGSVFTFNSLIGKVIKVAMDAAVEDVNASP 61

Query:    65 AILGGTKLKLTVHDTNYSRFLGMVEALTLLENETVAIIGPQFSVIAHLVSHIANEFQVPL 124
             +IL  T L++ +HDT Y+ F+ ++E L  +E+ETVAIIGPQ S  A +V+H+A E ++P+
Sbjct:    62 SILNTTTLRIIMHDTKYNGFMSIMEPLQFMESETVAIIGPQRSTTARVVAHVATELKIPI 121

Query:   125 LSFAATDPSLSSLQYPFFVRTTQSDLYQMAAIADIVDYFGWRNVIALYVDDDHGRNGIAA 184
             LSF+ATDP++S LQ+PFF+RT+Q+DL+QMAAIADIV ++GWR V+A+Y DDD+GRNG+AA
Sbjct:   122 LSFSATDPTMSPLQFPFFIRTSQNDLFQMAAIADIVQFYGWREVVAIYGDDDYGRNGVAA 181

Query:   185 LGDKLAEKRCRLSHKVPLSPKGSRNQIIDTLLTVSSMMSRILILHTYDIWGLEVLNAAKH 244
             LGD+L+EKRCR+S+K  L P  +R  I D L+ V+   SRI+++H   IWGLE+ N A++
Sbjct:   182 LGDRLSEKRCRISYKAALPPAPTRENITDLLIKVALSESRIIVVHASFIWGLELFNVARN 241

Query:   245 LRMMESGYVWIVTDWLSSILDTDSQLHSEKMDDIQGVLTLRMYTQSSEEKRKFVTRWRHL 304
             L MM +GYVWI T+WLS+I+DTDS L  + +++IQGV+TLR++T +S  K+ FV RW +L
Sbjct:   242 LGMMSTGYVWIATNWLSTIIDTDSPLPLDTINNIQGVITLRLHTPNSIMKQNFVQRWHNL 301

Query:   305 TRRNTLNGPIGLNSFGLYAYDTLWLLAHAIGAFFDQGGNISFSEDSKLSELSRGDMRFSS 364
             T        +GL+++ LYAYDT+WLLA AI  FF +GGN+SFS++  +SEL  G++   +
Sbjct:   302 TH-------VGLSTYALYAYDTVWLLAQAIDDFFKKGGNVSFSKNPIISELGGGNLHLDA 354

Query:   365 VSIFNGGKMLLDNILQVNMTGVTGPIKFTSDRDLINPAYEVINVIGTGSRRIGYWSNHSG 424
             + +F+GGK+ L++ILQV+  G+TG +KFTSDR+L+NPA++V+NVIGTG   IGYW NHSG
Sbjct:   355 LKVFDGGKIFLESILQVDRIGLTGRMKFTSDRNLVNPAFDVLNVIGTGYTTIGYWFNHSG 414

Query:   425 LSVVPPEALYKEPSNRSASSQHLYSAVWPGQTTQKPRGWVFPNNGRHLRIGVPSQVIYPE 484
             LSV+P +    E  N S S Q L+S VWPG + + PRGWVF NNGRHLRIGVP++  + E
Sbjct:   415 LSVMPAD----EMENTSFSGQKLHSVVWPGHSIKIPRGWVFSNNGRHLRIGVPNRYRFEE 470

Query:   485 FVAQGKGTDKFSGYCIDVFTAVLELLPYAVPYKLVPFGDGHNSPKRFDLLRLVSEEVYDA 544
              V+  K     +G+C+DVF A + LLPYAVP++LV FG+GH++P   +L+RL++  VYDA
Sbjct:   471 VVSV-KSNGMITGFCVDVFIAAINLLPYAVPFELVAFGNGHDNPSNSELVRLITTGVYDA 529

Query:   545 AVGDFAITTERTKMVDFTQPYIESGLVVVAPIKKLNSNAWAFLNPFTPKMWCVTGIFFLV 604
              VGD  I TERTKM DFTQPY+ESGLVVVAP++KL S+A AFL PFTP+MW +    FL+
Sbjct:   530 GVGDITIITERTKMADFTQPYVESGLVVVAPVRKLGSSAMAFLRPFTPQMWLIAAASFLI 589

Query:   605 VGVVVWILEHRLNDDFRGPPRRQIGTILW 633
             VG V+W LEH+ ND+FRGPPRRQ+ T  W
Sbjct:   590 VGAVIWCLEHKHNDEFRGPPRRQVITTFW 618
GO:0004965 "G-protein coupled GABA receptor activity" evidence=IEA
GO:0004970 "ionotropic glutamate receptor activity" evidence=IEA
GO:0005215 "transporter activity" evidence=IEA
GO:0005217 "intracellular ligand-gated ion channel activity" evidence=ISS
GO:0005234 "extracellular-glutamate-gated ion channel activity" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0006810 "transport" evidence=IEA
GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0006874 "cellular calcium ion homeostasis" evidence=NAS
GO:0009416 "response to light stimulus" evidence=NAS
GO:0030003 "cellular cation homeostasis" evidence=RCA
TAIR|locus:2206095 GLR3.3 "glutamate receptor 3.3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122128 GLUR2 "glutamate receptor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207165 GLR3.4 "AT1G05200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062586 GLR5 "glutamate receptor 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047251 GLR2.3 "glutamate receptor 2.3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066107 GLR2.7 "glutamate receptor 2.7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047256 GLR2.2 "glutamate receptor 2.2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181196 GLR2.1 "glutamate receptor 2.1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066086 GLR2.8 "glutamate receptor 2.8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q84W41GLR36_ARATHNo assigned EC number0.55000.97310.6821yesno
Q7XP59GLR31_ORYSJNo assigned EC number0.51450.97630.6588yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query633
cd06366350 cd06366, PBP1_GABAb_receptor, Ligand-binding domai 1e-127
pfam01094343 pfam01094, ANF_receptor, Receptor family ligand bi 1e-80
cd06350348 cd06350, PBP1_GPCR_family_C_like, Ligand-binding d 2e-69
cd06269298 cd06269, PBP1_glutamate_receptors_like, Family C G 2e-48
cd06352389 cd06352, PBP1_NPR_GC_like, Ligand-binding domain o 1e-27
cd06268298 cd06268, PBP1_ABC_transporter_LIVBP_like, Periplas 2e-25
cd06362452 cd06362, PBP1_mGluR, Ligand binding domain of the 3e-25
cd04509299 cd04509, PBP1_ABC_transporter_GCPR_C_like, Family 5e-24
cd06376463 cd06376, PBP1_mGluR_groupIII, Ligand-binding domai 1e-20
cd06351328 cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leuci 2e-20
cd06368324 cd06368, PBP1_iGluR_non_NMDA_like, N-terminal leuc 7e-19
cd06382327 cd06382, PBP1_iGluR_Kainate, N-terminal leucine/is 1e-16
COG0683366 COG0683, LivK, ABC-type branched-chain amino acid 2e-16
cd06375458 cd06375, PBP1_mGluR_groupII, Ligand binding domain 2e-15
cd06379377 cd06379, PBP1_iGluR_NMDA_NR1, N-terminal leucine/i 2e-15
cd06363410 cd06363, PBP1_Taste_receptor, Ligand-binding domai 9e-15
cd06364510 cd06364, PBP1_CaSR, Ligand-binding domain of the C 1e-14
cd01391269 cd01391, Periplasmic_Binding_Protein_Type_1, Type 1e-14
cd06370404 cd06370, PBP1_Speract_GC_like, Ligand-binding doma 2e-14
pfam13458343 pfam13458, Peripla_BP_6, Periplasmic binding prote 3e-14
cd06380382 cd06380, PBP1_iGluR_AMPA, N-terminal leucine/isole 2e-13
cd06340347 cd06340, PBP1_ABC_ligand_binding_like_6, Type I pe 8e-12
cd06374472 cd06374, PBP1_mGluR_groupI, Ligand binding domain 2e-11
cd06367362 cd06367, PBP1_iGluR_NMDA, N-terminal leucine/isole 7e-11
cd06361403 cd06361, PBP1_GPC6A_like, Ligand-binding domain of 1e-09
cd06346312 cd06346, PBP1_ABC_ligand_binding_like_11, Type I p 2e-09
pfam00497220 pfam00497, SBP_bac_3, Bacterial extracellular solu 4e-09
COG0834275 COG0834, HisJ, ABC-type amino acid transport/signa 5e-09
cd06373396 cd06373, PBP1_NPR_like, Ligand binding domain of n 1e-08
cd00134218 cd00134, PBPb, Bacterial periplasmic transport sys 2e-08
cd06333312 cd06333, PBP1_ABC-type_HAAT_like, Type I periplasm 3e-08
cd06342334 cd06342, PBP1_ABC_LIVBP_like, Type I periplasmic l 6e-08
smart00062219 smart00062, PBPb, Bacterial periplasmic substrate- 1e-07
cd06365469 cd06365, PBP1_Pheromone_receptor, Ligand-binding d 4e-07
pfam00060 268 pfam00060, Lig_chan, Ligand-gated ion channel 5e-07
cd06347334 cd06347, PBP1_ABC_ligand_binding_like_12, Type I p 6e-06
cd06393384 cd06393, PBP1_iGluR_Kainate_GluR5_7, N-terminal le 1e-05
cd06391400 cd06391, PBP1_iGluR_delta_2, N-terminal leucine/is 1e-05
cd06345344 cd06345, PBP1_ABC_ligand_binding_like_10, Type I p 2e-05
cd06330346 cd06330, PBP1_Arsenic_SBP_like, Periplasmic solute 6e-05
cd06335347 cd06335, PBP1_ABC_ligand_binding_like_2, Type I pe 8e-05
cd06339336 cd06339, PBP1_YraM_LppC_lipoprotein_like, Periplas 1e-04
cd06338345 cd06338, PBP1_ABC_ligand_binding_like_5, Type I pe 2e-04
cd06392400 cd06392, PBP1_iGluR_delta_1, N-terminal leucine/is 3e-04
cd06388371 cd06388, PBP1_iGluR_AMPA_GluR4, N-terminal leucine 0.001
PRK09495247 PRK09495, glnH, glutamine ABC transporter periplas 0.001
cd06383368 cd06383, PBP1_iGluR_AMPA_Like, N-terminal leucine/ 0.003
cd06386387 cd06386, PBP1_NPR_C_like, Ligand-binding domain of 0.004
>gnl|CDD|107361 cd06366, PBP1_GABAb_receptor, Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information 
 Score =  378 bits (974), Expect = e-127
 Identities = 154/400 (38%), Positives = 208/400 (52%), Gaps = 56/400 (14%)

Query: 34  NIGAVFALN-STIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFLGMVEALT 92
            IGA+F L+ S IGK A  AIE A+EDVN++ +IL G +L L V D+          AL 
Sbjct: 1   RIGAIFDLSGSWIGKAALPAIEMALEDVNADNSILPGYRLVLHVRDSKCDPVQAASAALD 60

Query: 93  LLENE-TVAIIGPQFSVIAHLVSHIANEFQVPLLSFAATDPSLSS-LQYPFFVRTTQSDL 150
           LLEN+  VAIIGPQ S +A  V+ +ANE+ VP+LSFAAT PSLSS LQYP+F RTT SD 
Sbjct: 61  LLENKPVVAIIGPQCSSVAEFVAEVANEWNVPVLSFAATSPSLSSRLQYPYFFRTTPSDS 120

Query: 151 YQMAAIADIVDYFGWRNVIALYVDDDHGRNGIAALGDKLAEKRCRLSHKVPLSPKGSRNQ 210
            Q  AIA ++  FGWR V  +Y DDD+G  G+  L D L E    +S++    P  + + 
Sbjct: 121 SQNPAIAALLKKFGWRRVATIYEDDDYGSGGLPDLVDALQEAGIEISYRAAFPPSANDDD 180

Query: 211 IIDTLLTVSSMMSRILILHTYDIWGLEVLNAAKHLRMMESGYVWIVTDWLSSILD-TDSQ 269
           I D L  +    SR++++H        V   A  L MM  GYVWI+TDWLSS    +   
Sbjct: 181 ITDALKKLKEKDSRVIVVHFSPDLARRVFCEAYKLGMMGKGYVWILTDWLSSNWWSSSDC 240

Query: 270 LHSEKMDDIQGVLTLRMYTQ-SSEEKRKFVTRWRHLTRRNTLNGPIGLNSFGLYAYDTLW 328
              E ++ +QGV+ +R Y   SS   ++F +RWR     N        + + LYAYD +W
Sbjct: 241 TDEEMLEAMQGVIGVRSYVPNSSMTLQEFTSRWRKR-FGNENPELTEPSIYALYAYDAVW 299

Query: 329 LLAHAIGAFFDQGGNISFSEDSKLSELSRGDMRFSSVSIFNGGKMLLDNILQVNMTGVTG 388
                                                                N  G++G
Sbjct: 300 --------------------------------------------------ASTNFNGLSG 309

Query: 389 PIKFTSDRDLINPAYEVINVIGTGSRRIGYWSNHSGLSVV 428
           P++F   R L +PA+E+IN+IG G R+IG+WS+ SGLSV 
Sbjct: 310 PVQFDGGRRLASPAFEIINIIGKGYRKIGFWSSESGLSVF 349

Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA). GABA is the major inhibitory neurotransmitter in the mammalian CNS and, like glutamate and other transmitters, acts via both ligand gated ion channels (GABAa receptors) and G-protein coupled receptors (GABAb). GABAa receptors are members of the ionotropic receptor superfamily which includes alpha-adrenergic and glycine receptors. The GABAb receptor is a member of a receptor superfamily which includes the mGlu receptors. The GABAb receptor is coupled to G alpha_i proteins, and activation causes a decrease in calcium, an increase in potassium membrane conductance, and inhibition of cAMP formation. The response is thus inhibitory and leads to hyperpolarization and decreased neurotransmitter release, for example. Length = 350
>gnl|CDD|216296 pfam01094, ANF_receptor, Receptor family ligand binding region Back     alignment and domain information
>gnl|CDD|153138 cd06350, PBP1_GPCR_family_C_like, Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) Back     alignment and domain information
>gnl|CDD|153137 cd06269, PBP1_glutamate_receptors_like, Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors Back     alignment and domain information
>gnl|CDD|107347 cd06352, PBP1_NPR_GC_like, Ligand-binding domain of membrane guanylyl-cyclase receptors Back     alignment and domain information
>gnl|CDD|107263 cd06268, PBP1_ABC_transporter_LIVBP_like, Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily Back     alignment and domain information
>gnl|CDD|107357 cd06362, PBP1_mGluR, Ligand binding domain of the metabotropic glutamate receptors (mGluR) Back     alignment and domain information
>gnl|CDD|107261 cd04509, PBP1_ABC_transporter_GCPR_C_like, Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems Back     alignment and domain information
>gnl|CDD|107371 cd06376, PBP1_mGluR_groupIII, Ligand-binding domain of the group III metabotropic glutamate receptor Back     alignment and domain information
>gnl|CDD|107346 cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) Back     alignment and domain information
>gnl|CDD|107363 cd06368, PBP1_iGluR_non_NMDA_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors Back     alignment and domain information
>gnl|CDD|107377 cd06382, PBP1_iGluR_Kainate, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors Back     alignment and domain information
>gnl|CDD|223755 COG0683, LivK, ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|107370 cd06375, PBP1_mGluR_groupII, Ligand binding domain of the group II metabotropic glutamate receptor Back     alignment and domain information
>gnl|CDD|107374 cd06379, PBP1_iGluR_NMDA_NR1, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor Back     alignment and domain information
>gnl|CDD|107358 cd06363, PBP1_Taste_receptor, Ligand-binding domain of the T1R taste receptor Back     alignment and domain information
>gnl|CDD|107359 cd06364, PBP1_CaSR, Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>gnl|CDD|107248 cd01391, Periplasmic_Binding_Protein_Type_1, Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>gnl|CDD|107365 cd06370, PBP1_Speract_GC_like, Ligand-binding domain of membrane bound guanylyl cyclases Back     alignment and domain information
>gnl|CDD|222144 pfam13458, Peripla_BP_6, Periplasmic binding protein Back     alignment and domain information
>gnl|CDD|107375 cd06380, PBP1_iGluR_AMPA, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor Back     alignment and domain information
>gnl|CDD|107335 cd06340, PBP1_ABC_ligand_binding_like_6, Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>gnl|CDD|107369 cd06374, PBP1_mGluR_groupI, Ligand binding domain of the group I metabotropic glutamate receptor Back     alignment and domain information
>gnl|CDD|107362 cd06367, PBP1_iGluR_NMDA, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors Back     alignment and domain information
>gnl|CDD|107356 cd06361, PBP1_GPC6A_like, Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor Back     alignment and domain information
>gnl|CDD|107341 cd06346, PBP1_ABC_ligand_binding_like_11, Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>gnl|CDD|215950 pfam00497, SBP_bac_3, Bacterial extracellular solute-binding proteins, family 3 Back     alignment and domain information
>gnl|CDD|223904 COG0834, HisJ, ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|107368 cd06373, PBP1_NPR_like, Ligand binding domain of natriuretic peptide receptor (NPR) family Back     alignment and domain information
>gnl|CDD|238078 cd00134, PBPb, Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>gnl|CDD|107328 cd06333, PBP1_ABC-type_HAAT_like, Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids Back     alignment and domain information
>gnl|CDD|107337 cd06342, PBP1_ABC_LIVBP_like, Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) Back     alignment and domain information
>gnl|CDD|214497 smart00062, PBPb, Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>gnl|CDD|107360 cd06365, PBP1_Pheromone_receptor, Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>gnl|CDD|215685 pfam00060, Lig_chan, Ligand-gated ion channel Back     alignment and domain information
>gnl|CDD|107342 cd06347, PBP1_ABC_ligand_binding_like_12, Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>gnl|CDD|107388 cd06393, PBP1_iGluR_Kainate_GluR5_7, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor Back     alignment and domain information
>gnl|CDD|107386 cd06391, PBP1_iGluR_delta_2, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family Back     alignment and domain information
>gnl|CDD|107340 cd06345, PBP1_ABC_ligand_binding_like_10, Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>gnl|CDD|107325 cd06330, PBP1_Arsenic_SBP_like, Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>gnl|CDD|107330 cd06335, PBP1_ABC_ligand_binding_like_2, Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>gnl|CDD|107334 cd06339, PBP1_YraM_LppC_lipoprotein_like, Periplasmic binding component of lipoprotein LppC, an immunodominant antigen Back     alignment and domain information
>gnl|CDD|107333 cd06338, PBP1_ABC_ligand_binding_like_5, Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>gnl|CDD|107387 cd06392, PBP1_iGluR_delta_1, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family Back     alignment and domain information
>gnl|CDD|107383 cd06388, PBP1_iGluR_AMPA_GluR4, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor Back     alignment and domain information
>gnl|CDD|236540 PRK09495, glnH, glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>gnl|CDD|107378 cd06383, PBP1_iGluR_AMPA_Like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors Back     alignment and domain information
>gnl|CDD|107381 cd06386, PBP1_NPR_C_like, Ligand-binding domain of type C natriuretic peptide receptor Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 633
KOG1054 897 consensus Glutamate-gated AMPA-type ion channel re 100.0
KOG4440 993 consensus NMDA selective glutamate-gated ion chann 100.0
KOG1053 1258 consensus Glutamate-gated NMDA-type ion channel re 100.0
cd06362452 PBP1_mGluR Ligand binding domain of the metabotrop 100.0
cd06374472 PBP1_mGluR_groupI Ligand binding domain of the gro 100.0
cd06375458 PBP1_mGluR_groupII Ligand binding domain of the gr 100.0
cd06364510 PBP1_CaSR Ligand-binding domain of the CaSR calciu 100.0
cd06376463 PBP1_mGluR_groupIII Ligand-binding domain of the g 100.0
cd06393384 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isol 100.0
cd06392400 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/v 100.0
cd06365469 PBP1_Pheromone_receptor Ligand-binding domain of t 100.0
cd06361403 PBP1_GPC6A_like Ligand-binding domain of the promi 100.0
cd06379377 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/ 100.0
cd06390364 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucin 100.0
cd06367362 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/vali 100.0
cd06386387 PBP1_NPR_C_like Ligand-binding domain of type C na 100.0
cd06387372 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucin 100.0
cd06380382 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/vali 100.0
cd06366350 PBP1_GABAb_receptor Ligand-binding domain of GABAb 100.0
cd06370404 PBP1_Speract_GC_like Ligand-binding domain of memb 100.0
cd06363410 PBP1_Taste_receptor Ligand-binding domain of the T 100.0
cd06388371 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucin 100.0
cd06389370 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucin 100.0
cd06385405 PBP1_NPR_A Ligand-binding domain of type A natriur 100.0
cd06391400 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/v 100.0
cd06373396 PBP1_NPR_like Ligand binding domain of natriuretic 100.0
cd06372391 PBP1_GC_G_like Ligand-binding domain of membrane g 100.0
cd06352389 PBP1_NPR_GC_like Ligand-binding domain of membrane 100.0
cd06371382 PBP1_sensory_GC_DEF_like Ligand-binding domain of 100.0
cd06382327 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/v 100.0
cd06384399 PBP1_NPR_B Ligand-binding domain of type B natriur 100.0
KOG1056 878 consensus Glutamate-gated metabotropic ion channel 100.0
cd06394333 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleu 100.0
PF01094348 ANF_receptor: Receptor family ligand binding regio 100.0
PRK15404369 leucine ABC transporter subunit substrate-binding 100.0
cd06342334 PBP1_ABC_LIVBP_like Type I periplasmic ligand-bind 100.0
cd06368324 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleu 100.0
cd06381363 PBP1_iGluR_delta_like N-terminal leucine/isoleucin 100.0
cd06345344 PBP1_ABC_ligand_binding_like_10 Type I periplasmic 100.0
cd06338345 PBP1_ABC_ligand_binding_like_5 Type I periplasmic 100.0
cd06346312 PBP1_ABC_ligand_binding_like_11 Type I periplasmic 100.0
cd06348344 PBP1_ABC_ligand_binding_like_13 Type I periplasmic 100.0
cd06350348 PBP1_GPCR_family_C_like Ligand-binding domain of m 100.0
cd06378362 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/ 100.0
cd06340347 PBP1_ABC_ligand_binding_like_6 Type I periplasmic 100.0
cd06355348 PBP1_FmdD_like Periplasmic component (FmdD) of an 100.0
cd06344332 PBP1_ABC_ligand_binding_like_9 Type I periplasmic 100.0
TIGR03669374 urea_ABC_arch urea ABC transporter, substrate-bind 100.0
COG0683366 LivK ABC-type branched-chain amino acid transport 100.0
cd06329342 PBP1_SBP_like_3 Periplasmic solute-binding domain 100.0
cd06377382 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/ 100.0
cd06347334 PBP1_ABC_ligand_binding_like_12 Type I periplasmic 100.0
cd06331333 PBP1_AmiC_like Type I periplasmic components of am 100.0
cd06383368 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine 100.0
cd06343362 PBP1_ABC_ligand_binding_like_8 Type I periplasmic 100.0
TIGR03407359 urea_ABC_UrtA urea ABC transporter, urea binding p 100.0
cd06349340 PBP1_ABC_ligand_binding_like_14 Type I periplasmic 100.0
cd06327334 PBP1_SBP_like_1 Periplasmic solute-binding domain 100.0
cd06336347 PBP1_ABC_ligand_binding_like_3 Type I periplasmic 100.0
PF13458343 Peripla_BP_6: Periplasmic binding protein; PDB: 4E 100.0
cd06330346 PBP1_Arsenic_SBP_like Periplasmic solute-binding d 100.0
cd06359333 PBP1_Nba_like Type I periplasmic binding component 100.0
cd06357360 PBP1_AmiC Periplasmic binding domain of amidase (A 100.0
cd06328333 PBP1_SBP_like_2 Periplasmic solute-binding domain 100.0
cd06360336 PBP1_alkylbenzenes_like Type I periplasmic binding 100.0
KOG1052 656 consensus Glutamate-gated kainate-type ion channel 100.0
cd06351328 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleuc 100.0
cd06334351 PBP1_ABC_ligand_binding_like_1 Type I periplasmic 100.0
cd06335347 PBP1_ABC_ligand_binding_like_2 Type I periplasmic 100.0
cd06356334 PBP1_Amide_Urea_BP_like Periplasmic component (Fmd 100.0
cd06358333 PBP1_NHase Type I periplasmic-binding protein of t 100.0
cd06332333 PBP1_aromatic_compounds_like Type I periplasmic bi 100.0
PF13433363 Peripla_BP_5: Periplasmic binding protein domain; 100.0
KOG1055 865 consensus GABA-B ion channel receptor subunit GABA 100.0
cd06337357 PBP1_ABC_ligand_binding_like_4 Type I periplasmic 99.98
cd06326336 PBP1_STKc_like Type I periplasmic binding domain o 99.97
cd06339336 PBP1_YraM_LppC_lipoprotein_like Periplasmic bindin 99.97
TIGR03863347 PQQ_ABC_bind ABC transporter, substrate binding pr 99.96
cd06341341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic 99.96
cd06269298 PBP1_glutamate_receptors_like Family C G-protein c 99.96
cd06333312 PBP1_ABC-type_HAAT_like Type I periplasmic binding 99.96
cd04509299 PBP1_ABC_transporter_GCPR_C_like Family C of G-pro 99.95
cd06369380 PBP1_GC_C_enterotoxin_receptor Ligand-binding doma 99.95
cd06268298 PBP1_ABC_transporter_LIVBP_like Periplasmic bindin 99.94
cd01391269 Periplasmic_Binding_Protein_Type_1 Type 1 periplas 99.65
PF04348536 LppC: LppC putative lipoprotein; InterPro: IPR0074 99.43
PRK11917259 bifunctional adhesin/ABC transporter aspartate/glu 99.36
PRK10797 302 glutamate and aspartate transporter subunit; Provi 99.33
PRK15437259 histidine ABC transporter substrate-binding protei 99.3
PRK15010260 ABC transporter lysine/arginine/ornithine binding 99.29
PRK09495247 glnH glutamine ABC transporter periplasmic protein 99.28
PF00497225 SBP_bac_3: Bacterial extracellular solute-binding 99.22
PRK15007243 putative ABC transporter arginine-biding protein; 99.2
TIGR02995275 ectoine_ehuB ectoine/hydroxyectoine ABC transporte 99.18
PRK11260266 cystine transporter subunit; Provisional 99.16
TIGR01096250 3A0103s03R lysine-arginine-ornithine-binding perip 99.13
TIGR03870246 ABC_MoxJ methanol oxidation system protein MoxJ. T 99.07
PF1061365 Lig_chan-Glu_bd: Ligated ion channel L-glutamate- 99.02
cd01537264 PBP1_Repressors_Sugar_Binding_like Ligand-binding 98.99
PRK10859 482 membrane-bound lytic transglycosylase F; Provision 98.97
cd01536267 PBP1_ABC_sugar_binding_like Periplasmic sugar-bind 98.95
TIGR02285268 conserved hypothetical protein. Members of this fa 98.89
cd06267264 PBP1_LacI_sugar_binding_like Ligand binding domain 98.89
cd06300272 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-bi 98.87
PRK09959 1197 hybrid sensory histidine kinase in two-component r 98.81
PRK09959 1197 hybrid sensory histidine kinase in two-component r 98.8
COG0834275 HisJ ABC-type amino acid transport/signal transduc 98.8
TIGR03871232 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associa 98.74
COG2984322 ABC-type uncharacterized transport system, peripla 98.73
cd06325281 PBP1_ABC_uncharacterized_transporter Type I peripl 98.73
cd06320275 PBP1_allose_binding Periplasmic allose-binding dom 98.68
cd00134218 PBPb Bacterial periplasmic transport systems use m 98.61
PRK10653295 D-ribose transporter subunit RbsB; Provisional 98.6
cd06282266 PBP1_GntR_like_2 Ligand-binding domain of putative 98.57
COG3107604 LppC Putative lipoprotein [General function predic 98.52
smart00062219 PBPb Bacterial periplasmic substrate-binding prote 98.52
cd06323268 PBP1_ribose_binding Periplasmic sugar-binding doma 98.46
cd06317275 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-bi 98.43
cd06273268 PBP1_GntR_like_1 This group includes the ligand-bi 98.43
cd06310273 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-bi 98.41
cd06319277 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-b 98.41
cd06312271 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-bi 98.39
cd06305273 PBP1_methylthioribose_binding_like Methylthioribos 98.38
cd06301272 PBP1_rhizopine_binding_like Periplasmic binding pr 98.38
PRK10936343 TMAO reductase system periplasmic protein TorT; Pr 98.32
PF13407257 Peripla_BP_4: Periplasmic binding protein domain; 98.31
PRK09701311 D-allose transporter subunit; Provisional 98.29
cd01545270 PBP1_SalR Ligand-binding domain of DNA transcripti 98.29
PRK15395330 methyl-galactoside ABC transporter galactose-bindi 98.25
cd06298268 PBP1_CcpA_like Ligand-binding domain of the catabo 98.22
cd06309273 PBP1_YtfQ_like Periplasmic binding domain of ABC-t 98.21
cd06289268 PBP1_MalI_like Ligand-binding domain of MalI, a tr 98.19
cd06284267 PBP1_LacI_like_6 Ligand-binding domain of an uncha 98.16
cd06303280 PBP1_LuxPQ_Quorum_Sensing Periplasmic binding prot 98.14
cd01539303 PBP1_GGBP Periplasmic glucose/galactose-binding pr 98.14
COG4623 473 Predicted soluble lytic transglycosylase fused to 98.11
cd01540289 PBP1_arabinose_binding Periplasmic L-arabinose-bin 98.06
cd06311274 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-bi 98.06
cd06288269 PBP1_sucrose_transcription_regulator Ligand-bindin 98.05
cd06321271 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-b 98.04
COG1879322 RbsB ABC-type sugar transport system, periplasmic 98.04
cd06275269 PBP1_PurR Ligand-binding domain of purine represso 98.03
cd01575268 PBP1_GntR Ligand-binding domain of DNA transcripti 98.02
cd06322267 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-b 98.01
TIGR01481329 ccpA catabolite control protein A. Catabolite cont 98.0
PF00532279 Peripla_BP_1: Periplasmic binding proteins and sug 98.0
cd06306268 PBP1_TorT-like TorT-like proteins, a periplasmic b 97.99
cd06283267 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of 97.98
PRK10355330 xylF D-xylose transporter subunit XylF; Provisiona 97.96
cd06271268 PBP1_AglR_RafR_like Ligand-binding domain of DNA t 97.95
cd01574264 PBP1_LacI Ligand-binding domain of DNA transcripti 97.94
cd06285265 PBP1_LacI_like_7 Ligand-binding domain of uncharac 97.94
cd06293269 PBP1_LacI_like_11 Ligand-binding domain of unchara 97.93
cd06324305 PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-b 97.92
cd06270268 PBP1_GalS_like Ligand binding domain of DNA transc 97.91
cd06308270 PBP1_sensor_kinase_like Periplasmic binding domain 97.91
cd06316294 PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-bi 97.9
cd06274264 PBP1_FruR Ligand binding domain of DNA transcripti 97.9
cd06281269 PBP1_LacI_like_5 Ligand-binding domain of uncharac 97.9
PRK10703341 DNA-binding transcriptional repressor PurR; Provis 97.9
cd06299265 PBP1_LacI_like_13 Ligand-binding domain of DNA-bin 97.89
cd01542259 PBP1_TreR_like Ligand-binding domain of DNA transc 97.89
cd06295275 PBP1_CelR Ligand binding domain of a transcription 97.88
PRK10014342 DNA-binding transcriptional repressor MalI; Provis 97.87
cd06278266 PBP1_LacI_like_2 Ligand-binding domain of uncharac 97.86
PF04392294 ABC_sub_bind: ABC transporter substrate binding pr 97.83
PRK15408336 autoinducer 2-binding protein lsrB; Provisional 97.83
cd06292273 PBP1_LacI_like_10 Ligand-binding domain of unchara 97.82
cd01538288 PBP1_ABC_xylose_binding Periplasmic xylose-binding 97.82
PRK11303328 DNA-binding transcriptional regulator FruR; Provis 97.81
cd06296270 PBP1_CatR_like Ligand-binding domain of a LacI-lik 97.8
cd06290265 PBP1_LacI_like_9 Ligand-binding domain of uncharac 97.78
cd06318282 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-bi 97.77
PRK10423327 transcriptional repressor RbsR; Provisional 97.77
cd06291265 PBP1_Qymf_like Ligand binding domain of the lacI-l 97.74
cd06307275 PBP1_uncharacterized_sugar_binding Periplasmic sug 97.73
cd06286260 PBP1_CcpB_like Ligand-binding domain of a novel tr 97.73
cd06314271 PBP1_tmGBP Periplasmic sugar-binding domain of The 97.71
COG1609333 PurR Transcriptional regulators [Transcription] 97.69
cd06294270 PBP1_ycjW_transcription_regulator_like Ligand-bind 97.69
cd06313272 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-bi 97.68
TIGR02417327 fruct_sucro_rep D-fructose-responsive transcriptio 97.66
cd06280263 PBP1_LacI_like_4 Ligand-binding domain of uncharac 97.65
cd06272261 PBP1_hexuronate_repressor_like Ligand-binding doma 97.65
TIGR02955295 TMAO_TorT TMAO reductase system periplasmic protei 97.64
cd06354265 PBP1_BmpA_PnrA_like Periplasmic binding domain of 97.62
PRK10727343 DNA-binding transcriptional regulator GalR; Provis 97.6
cd06302298 PBP1_LsrB_Quorum_Sensing Periplasmic binding domai 97.6
cd06277268 PBP1_LacI_like_1 Ligand-binding domain of uncharac 97.6
PRK09526342 lacI lac repressor; Reviewed 97.59
cd06279283 PBP1_LacI_like_3 Ligand-binding domain of uncharac 97.58
cd06304260 PBP1_BmpA_like Periplasmic binding component of a 97.58
cd06297269 PBP1_LacI_like_12 Ligand-binding domain of unchara 97.57
cd01541273 PBP1_AraR Ligand-binding domain of DNA transcripti 97.54
PRK09492315 treR trehalose repressor; Provisional 97.5
cd01543265 PBP1_XylR Ligand-binding domain of DNA transcripti 97.5
PRK14987331 gluconate operon transcriptional regulator; Provis 97.41
PRK10401346 DNA-binding transcriptional regulator GalS; Provis 97.4
PRK11041309 DNA-binding transcriptional regulator CytR; Provis 97.37
TIGR02405311 trehalos_R_Ecol trehalose operon repressor, proteo 97.16
TIGR02634302 xylF D-xylose ABC transporter, substrate-binding p 97.15
TIGR02637302 RhaS rhamnose ABC transporter, rhamnose-binding pr 96.96
cd01544270 PBP1_GalR Ligand-binding domain of DNA transcripti 96.95
cd06315280 PBP1_ABC_sugar_binding_like_6 Periplasmic sugar-bi 96.77
cd06353258 PBP1_BmpA_Med_like Periplasmic binding domain of t 96.59
TIGR01098254 3A0109s03R phosphate/phosphite/phosphonate ABC tra 96.49
TIGR02990239 ectoine_eutA ectoine utilization protein EutA. Mem 96.26
cd06287269 PBP1_LacI_like_8 Ligand-binding domain of uncharac 95.9
cd06276247 PBP1_FucR_like Ligand-binding domain of a transcri 95.29
COG1744345 Med Uncharacterized ABC-type transport system, per 95.23
PRK10339327 DNA-binding transcriptional repressor EbgR; Provis 95.17
COG4213341 XylF ABC-type xylose transport system, periplasmic 94.83
COG3473238 Maleate cis-trans isomerase [Secondary metabolites 93.68
PRK00489 287 hisG ATP phosphoribosyltransferase; Reviewed 93.56
PF02608306 Bmp: Basic membrane protein; InterPro: IPR003760 T 93.03
COG1794230 RacX Aspartate racemase [Cell envelope biogenesis, 92.65
PF13377160 Peripla_BP_3: Periplasmic binding protein-like dom 92.64
TIGR00035229 asp_race aspartate racemase. 92.4
COG1454377 EutG Alcohol dehydrogenase, class IV [Energy produ 91.9
PRK09860383 putative alcohol dehydrogenase; Provisional 91.14
cd06353258 PBP1_BmpA_Med_like Periplasmic binding domain of t 91.0
PF03808172 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/Cp 90.95
cd08192370 Fe-ADH7 Iron-containing alcohol dehydrogenases-lik 89.87
PRK15454395 ethanol dehydrogenase EutG; Provisional 89.5
cd08190414 HOT Hydroxyacid-oxoacid transhydrogenase (HOT) inv 89.39
cd08189374 Fe-ADH5 Iron-containing alcohol dehydrogenases-lik 89.33
TIGR03431 288 PhnD phosphonate ABC transporter, periplasmic phos 88.96
cd08193376 HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyze 88.87
PRK10624382 L-1,2-propanediol oxidoreductase; Provisional 88.59
cd08551370 Fe-ADH iron-containing alcohol dehydrogenases (Fe- 88.3
cd08194375 Fe-ADH6 Iron-containing alcohol dehydrogenases-lik 88.25
PRK10200230 putative racemase; Provisional 87.75
cd06533171 Glyco_transf_WecG_TagA The glycosyltransferase Wec 87.57
TIGR02638379 lactal_redase lactaldehyde reductase. This clade o 86.93
PF00465366 Fe-ADH: Iron-containing alcohol dehydrogenase ; In 86.34
cd08185380 Fe-ADH1 Iron-containing alcohol dehydrogenases-lik 86.13
PF12683275 DUF3798: Protein of unknown function (DUF3798); In 85.61
cd08188377 Fe-ADH4 Iron-containing alcohol dehydrogenases-lik 84.8
cd08176377 LPO Lactadehyde:propanediol oxidoreductase (LPO) c 84.14
PF01177216 Asp_Glu_race: Asp/Glu/Hydantoin racemase; InterPro 83.69
PRK07475245 hypothetical protein; Provisional 83.61
cd08181357 PPD-like 1,3-propanediol dehydrogenase-like (PPD). 83.53
cd08191386 HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyz 83.32
cd08182367 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) c 83.01
cd07766332 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) 81.92
cd08170351 GlyDH Glycerol dehydrogenases (GlyDH) catalyzes ox 81.62
PF06506176 PrpR_N: Propionate catabolism activator; InterPro: 81.61
PF02608306 Bmp: Basic membrane protein; InterPro: IPR003760 T 81.35
KOG3857465 consensus Alcohol dehydrogenase, class IV [Energy 80.98
PF13407257 Peripla_BP_4: Periplasmic binding protein domain; 80.7
cd08186383 Fe-ADH8 Iron-containing alcohol dehydrogenase. Typ 80.21
>KOG1054 consensus Glutamate-gated AMPA-type ion channel receptor subunit GluR2 and related subunits [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=5.3e-59  Score=454.82  Aligned_cols=545  Identities=18%  Similarity=0.291  Sum_probs=435.3

Q ss_pred             CCCeEEEEEEeecCCccchhHHHHHHHHHHHHhcCCCCCCC--cEEEEEEe--cCCCChHHHHHHHHHHHhcCceEEEcC
Q 006727           29 IPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGG--TKLKLTVH--DTNYSRFLGMVEALTLLENETVAIIGP  104 (633)
Q Consensus        29 ~~~~i~IG~l~p~~~~~g~~~~~a~~~Ave~iN~~~~il~g--~~l~~~~~--D~~~~~~~a~~~~~~li~~~v~aviG~  104 (633)
                      -+.+|.||.+||...   .+...|+++|+...|....- ..  .++...+.  +. .++.....+.|...+.||.||+|.
T Consensus        23 f~~tiqigglF~~n~---~qe~~Afr~~~~~~~~~~~~-~~~pf~L~~~~d~~e~-a~Sf~~tnafCsq~s~Gv~Aifg~   97 (897)
T KOG1054|consen   23 FPNTIQIGGLFPRNT---DQEHSAFRFAVQLYNTNQNT-TEKPFKLNPHVDNLES-ANSFAVTNAFCSQFSRGVYAIFGF   97 (897)
T ss_pred             CCCceeeccccCCcc---hHHHHHHHHHHHHhhcCCCC-CCCCcccccccchhhh-hhhHHHHHHHHHHHhhhHhhheec
Confidence            467899999999874   34578888888888765332 12  33333332  23 467777888999999999999999


Q ss_pred             CchhhHHHHHHhhccCCccEEeeccCCCCCccCCCCceEEecCChHHHHHHHHHHHHHcCCcEEEEEEecCCCcchhHHH
Q 006727          105 QFSVIAHLVSHIANEFQVPLLSFAATDPSLSSLQYPFFVRTTQSDLYQMAAIADIVDYFGWRNVIALYVDDDHGRNGIAA  184 (633)
Q Consensus       105 ~~s~~~~~va~~~~~~~iP~Is~~a~~~~ls~~~~~~~~r~~p~~~~~~~al~~ll~~~~w~~v~ii~~d~~~g~~~~~~  184 (633)
                      ++.-+...+..+|...++|+|+++...    +...++.+++.|+-.   .++++++.|++|.+|.++| |.+.|....+.
T Consensus        98 yd~ks~~~ltsfc~aLh~~~vtpsfp~----~~~~~Fviq~RP~l~---~al~s~i~hy~W~~fv~ly-D~~rg~s~Lqa  169 (897)
T KOG1054|consen   98 YDKKSVNTLTSFCGALHVSFVTPSFPT----DGDNQFVIQMRPALK---GALLSLIDHYKWEKFVYLY-DTDRGLSILQA  169 (897)
T ss_pred             ccccchhhhhhhccceeeeeecccCCc----CCCceEEEEeCchHH---HHHHHHHHhcccceEEEEE-cccchHHHHHH
Confidence            999999999999999999999975522    233477888888754   8899999999999999999 66788888999


Q ss_pred             HHHHHhhcCcEEEEEeecCCCCChhhHHHHHHHhhcCCCeEEEEeeChHHHHHHHHHHHHcCCCCCCeEEEEeCcccccc
Q 006727          185 LGDKLAEKRCRLSHKVPLSPKGSRNQIIDTLLTVSSMMSRILILHTYDIWGLEVLNAAKHLRMMESGYVWIVTDWLSSIL  264 (633)
Q Consensus       185 ~~~~~~~~g~~v~~~~~~~~~~~~~~~~~~l~~i~~~~~~vIvl~~~~~~~~~il~~a~~~g~~~~~~~~i~~~~~~~~~  264 (633)
                      +.+.+.++++.|.....-.. .+..+++.+++.+...+.+.|++.|..+...+++.++-+.+-...+||+++.+..-...
T Consensus       170 i~~~a~~~nw~VtA~~v~~~-~d~~~yr~~f~~l~~r~e~rv~iDce~~~~~~il~q~i~~~k~~~~YHYvlaNl~f~d~  248 (897)
T KOG1054|consen  170 IMEAAAQNNWQVTAINVGNI-NDVKEYRMLFEMLDRRQENRVLIDCESERRNRILLQVIELGKHVKGYHYVLANLGFTDI  248 (897)
T ss_pred             HHHHHHhcCceEEEEEcCCc-ccHHHHHHHHHHHhccccceEEEEcccHHHHHHHHHHHHHhhhccceEEEEeeCCCchh
Confidence            99999999999886653332 35566999999999999999999999999999999999888888999999988544444


Q ss_pred             CCCccccccccccccceEEEeeecCCChHHHHHHHHHHHhhcc-CCCCCCCCCCchhHHHhhHHHHHHHHHHHhhhcCCC
Q 006727          265 DTDSQLHSEKMDDIQGVLTLRMYTQSSEEKRKFVTRWRHLTRR-NTLNGPIGLNSFGLYAYDTLWLLAHAIGAFFDQGGN  343 (633)
Q Consensus       265 ~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~f~~~~~~~~~~-~~~~~~~~~~~~~~~~yDav~~~~~Al~~~~~~~~~  343 (633)
                      ++     +.+.....++.+++..+-+.+..++|.++|++.... .++.....++..+++.|||++++++|++.+.++..+
T Consensus       249 dl-----~~f~~g~aNitgFqivn~~~~~~~k~~~~~~~l~~~~~~g~~~~~~k~tsAlthDailV~~eaf~~~~~q~~~  323 (897)
T KOG1054|consen  249 DL-----ERFQHGGANITGFQIVNKNNPMVKKFIQRWKELDEREYPGASNDPIKYTSALTHDAILVMAEAFRSLRRQRID  323 (897)
T ss_pred             hH-----HHHhcCCcceeEEEEecCCChHHHHHHHHHhhhcccccCCCCCCCcchhhhhhhhHHHHHHHHHHHHHHhhhc
Confidence            43     445567778999999999999999999999876543 344444667788999999999999999999887665


Q ss_pred             cccccCcccccccCCCcccc--cccccCchHHHHHHHHhccccccccceEEccCCCCCCCcEEEEEeecCCeeEEeeecC
Q 006727          344 ISFSEDSKLSELSRGDMRFS--SVSIFNGGKMLLDNILQVNMTGVTGPIKFTSDRDLINPAYEVINVIGTGSRRIGYWSN  421 (633)
Q Consensus       344 ~~~~~~~~~~~~~~~~~~c~--~~~~~~~~~~l~~~l~~~~f~g~~G~v~Fd~~g~r~~~~~~I~~~~~~~~~~vg~w~~  421 (633)
                      .+-+.         ...+|.  +..+|..|..+.++++++.++|++|+|.||..|.|.|.+.+|++++.++-.++|+|..
T Consensus       324 ~~rRG---------~~GD~~an~~~p~~qG~~I~ralk~v~~eGLTGniqFd~~G~R~Nyt~~i~elk~~~~rk~~~W~e  394 (897)
T KOG1054|consen  324 ISRRG---------NAGDCLANPAVPWEQGIDIERALKQVQVEGLTGNIQFDKYGRRTNYTIDIVELKSNGSRKVGYWNE  394 (897)
T ss_pred             hhccC---------CCccccCCCCCchhcchhHHHHHHheeecccccceeecccCccccceEEEEEeccCCcceeeeecc
Confidence            43221         122343  4568999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcccCCccccCCCCCCCCCccccceeeeCCCCCCCCCcc-cccCCCceEEEEecCCCCCcCcEEec------CCCCc
Q 006727          422 HSGLSVVPPEALYKEPSNRSASSQHLYSAVWPGQTTQKPRGW-VFPNNGRHLRIGVPSQVIYPEFVAQG------KGTDK  494 (633)
Q Consensus       422 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~i~w~g~~~~~p~~~-~~~~~~~~l~v~~~~~~~~~p~~~~~------~~~~~  494 (633)
                      ..|+......                           .+.+. .-..+.+++.|.+.-  . .||.+..      .++++
T Consensus       395 ~~~fv~~~t~---------------------------a~~~~d~~~~~n~tvvvttiL--~-spyvm~kkn~~~~egn~r  444 (897)
T KOG1054|consen  395 GEGFVPGSTV---------------------------AQSRNDQASKENRTVVVTTIL--E-SPYVMLKKNHEQLEGNER  444 (897)
T ss_pred             cCceeecccc---------------------------ccccccccccccceEEEEEec--C-CchhHHHhhHHHhcCCcc
Confidence            8875432110                           00000 001134556666653  2 3444432      36889


Q ss_pred             eeeeeHHHHHHHHHHCCCccceEEEeCCCCC-----CCCC-HHhHHHHHHcCcccEEEeeeEeeccccceeeeccceeec
Q 006727          495 FSGYCIDVFTAVLELLPYAVPYKLVPFGDGH-----NSPK-RFDLLRLVSEEVYDAAVGDFAITTERTKMVDFTQPYIES  568 (633)
Q Consensus       495 ~~G~~vdl~~~ia~~l~~~~~~~~~~~~~~~-----~~~~-~~~~~~~l~~~~~d~~~~~~~~~~~r~~~~~fs~p~~~~  568 (633)
                      ++||||||+.+||++.+.+  |++..+++|+     .+++ |+||+++|..|++|++++++|||.+|++.+|||.||++.
T Consensus       445 yEGyCvdLa~~iAkhi~~~--Y~l~iv~dgkyGardaD~k~WnGMvGeLv~grAdiavApLTIt~~REeviDFSKPfMsl  522 (897)
T KOG1054|consen  445 YEGYCVDLAAEIAKHIGIK--YKLFIVGDGKYGARDADTKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSL  522 (897)
T ss_pred             cceeHHHHHHHHHHhcCce--EEEEEecCCcccccCCCcccccchhHHHhcCccceEEeeeeeehhhhhhhccccchhhc
Confidence            9999999999999999976  6666555555     5555 999999999999999999999999999999999999999


Q ss_pred             ceEEEEecCC-CCcCccccccCCchhHHHHHHHHHHHHHHHhhhhhcccCCCCCCC-------------cCCCcccccC
Q 006727          569 GLVVVAPIKK-LNSNAWAFLNPFTPKMWCVTGIFFLVVGVVVWILEHRLNDDFRGP-------------PRRQIGTILW  633 (633)
Q Consensus       569 ~~~~lv~~~~-~~~~~~~~l~pf~~~~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------------~~~~~~~~~w  633 (633)
                      |++||+++|. ..++.|+||+|+..+.|+||+.+++.|+++++++.|++|+||+-.             +-++|.+++|
T Consensus       523 GISIMIKKPqKsk~gVFSFldPLa~eIWm~ivfaYiGVSvvlFLVSrFSPYEwh~Ee~~rg~~t~~~~~NeFgifNsLW  601 (897)
T KOG1054|consen  523 GISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFERGRFTPSDPPNEFGIFNSLW  601 (897)
T ss_pred             CeEEEEeCcccCCCCeeeecchhHHHHHHHHHHHHhcceEEEEEEeccCchheeccccccCCCCCCCCCccchhhHHHH
Confidence            9999999988 679999999999999999999999999999999999999987321             2267777777

>KOG4440 consensus NMDA selective glutamate-gated ion channel receptor subunit GRIN1 [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1053 consensus Glutamate-gated NMDA-type ion channel receptor subunit GRIN2A and related subunits [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd06362 PBP1_mGluR Ligand binding domain of the metabotropic glutamate receptors (mGluR) Back     alignment and domain information
>cd06374 PBP1_mGluR_groupI Ligand binding domain of the group I metabotropic glutamate receptor Back     alignment and domain information
>cd06375 PBP1_mGluR_groupII Ligand binding domain of the group II metabotropic glutamate receptor Back     alignment and domain information
>cd06364 PBP1_CaSR Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06376 PBP1_mGluR_groupIII Ligand-binding domain of the group III metabotropic glutamate receptor Back     alignment and domain information
>cd06393 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor Back     alignment and domain information
>cd06392 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06365 PBP1_Pheromone_receptor Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06361 PBP1_GPC6A_like Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor Back     alignment and domain information
>cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor Back     alignment and domain information
>cd06390 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor Back     alignment and domain information
>cd06367 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors Back     alignment and domain information
>cd06386 PBP1_NPR_C_like Ligand-binding domain of type C natriuretic peptide receptor Back     alignment and domain information
>cd06387 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor Back     alignment and domain information
>cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor Back     alignment and domain information
>cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information
>cd06370 PBP1_Speract_GC_like Ligand-binding domain of membrane bound guanylyl cyclases Back     alignment and domain information
>cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor Back     alignment and domain information
>cd06388 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor Back     alignment and domain information
>cd06389 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor Back     alignment and domain information
>cd06385 PBP1_NPR_A Ligand-binding domain of type A natriuretic peptide receptor Back     alignment and domain information
>cd06391 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06373 PBP1_NPR_like Ligand binding domain of natriuretic peptide receptor (NPR) family Back     alignment and domain information
>cd06372 PBP1_GC_G_like Ligand-binding domain of membrane guanylyl cyclase G Back     alignment and domain information
>cd06352 PBP1_NPR_GC_like Ligand-binding domain of membrane guanylyl-cyclase receptors Back     alignment and domain information
>cd06371 PBP1_sensory_GC_DEF_like Ligand-binding domain of membrane guanylyl cyclases (GC-D, GC-E, and GC-F) that are specifically expressed in sensory tissues Back     alignment and domain information
>cd06382 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors Back     alignment and domain information
>cd06384 PBP1_NPR_B Ligand-binding domain of type B natriuretic peptide receptor Back     alignment and domain information
>KOG1056 consensus Glutamate-gated metabotropic ion channel receptor subunit GRM2 and related subunits, G-protein coupled receptor superfamily [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd06394 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor Back     alignment and domain information
>PF01094 ANF_receptor: Receptor family ligand binding region The Prosite family is a sub-family of the Pfam family; InterPro: IPR001828 This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure [] Back     alignment and domain information
>PRK15404 leucine ABC transporter subunit substrate-binding protein LivK; Provisional Back     alignment and domain information
>cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) Back     alignment and domain information
>cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors Back     alignment and domain information
>cd06381 PBP1_iGluR_delta_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2 Back     alignment and domain information
>cd06345 PBP1_ABC_ligand_binding_like_10 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06338 PBP1_ABC_ligand_binding_like_5 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06348 PBP1_ABC_ligand_binding_like_13 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06350 PBP1_GPCR_family_C_like Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) Back     alignment and domain information
>cd06378 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family Back     alignment and domain information
>cd06340 PBP1_ABC_ligand_binding_like_6 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06355 PBP1_FmdD_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>cd06344 PBP1_ABC_ligand_binding_like_9 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>TIGR03669 urea_ABC_arch urea ABC transporter, substrate-binding protein, archaeal type Back     alignment and domain information
>COG0683 LivK ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism] Back     alignment and domain information
>cd06329 PBP1_SBP_like_3 Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>cd06377 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR3 subunit of NMDA receptor family Back     alignment and domain information
>cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06331 PBP1_AmiC_like Type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF) Back     alignment and domain information
>cd06383 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors Back     alignment and domain information
>cd06343 PBP1_ABC_ligand_binding_like_8 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>TIGR03407 urea_ABC_UrtA urea ABC transporter, urea binding protein Back     alignment and domain information
>cd06349 PBP1_ABC_ligand_binding_like_14 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems Back     alignment and domain information
>cd06327 PBP1_SBP_like_1 Periplasmic solute-binding domain of active transport proteins that belong to the type I periplasmic binding fold protein family Back     alignment and domain information
>cd06336 PBP1_ABC_ligand_binding_like_3 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>PF13458 Peripla_BP_6: Periplasmic binding protein; PDB: 4EVS_A 4EY3_A 4EYG_B 4EYK_A 3H5L_B 3TD9_A 3EAF_A 1Z18_A 1Z17_A 2LIV_A Back     alignment and domain information
>cd06330 PBP1_Arsenic_SBP_like Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>cd06359 PBP1_Nba_like Type I periplasmic binding component of active transport systems that are predicted to be involved in 2-nitrobenzoic acid degradation pathway Back     alignment and domain information
>cd06357 PBP1_AmiC Periplasmic binding domain of amidase (AmiC) that belongs to the type I periplasmic binding fold protein family Back     alignment and domain information
>cd06328 PBP1_SBP_like_2 Periplasmic solute-binding domain of active transport proteins found in gram-negative and gram-positive bacteria Back     alignment and domain information
>cd06360 PBP1_alkylbenzenes_like Type I periplasmic binding component of active transport systems that are predicted be involved in anaerobic biodegradation of alkylbenzenes such as toluene and ethylbenzene Back     alignment and domain information
>KOG1052 consensus Glutamate-gated kainate-type ion channel receptor subunit GluR5 and related subunits [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd06351 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) Back     alignment and domain information
>cd06334 PBP1_ABC_ligand_binding_like_1 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06335 PBP1_ABC_ligand_binding_like_2 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06356 PBP1_Amide_Urea_BP_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>cd06358 PBP1_NHase Type I periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides Back     alignment and domain information
>cd06332 PBP1_aromatic_compounds_like Type I periplasmic binding proteins of active transport systems that are predicted to be involved in transport of aromatic compounds such as 2-nitrobenzoic acid and alkylbenzenes Back     alignment and domain information
>PF13433 Peripla_BP_5: Periplasmic binding protein domain; PDB: 1QNL_A 1QO0_A 1PEA_A Back     alignment and domain information
>KOG1055 consensus GABA-B ion channel receptor subunit GABABR1 and related subunits, G-protein coupled receptor superfamily [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06326 PBP1_STKc_like Type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins Back     alignment and domain information
>cd06339 PBP1_YraM_LppC_lipoprotein_like Periplasmic binding component of lipoprotein LppC, an immunodominant antigen Back     alignment and domain information
>TIGR03863 PQQ_ABC_bind ABC transporter, substrate binding protein, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd06341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06269 PBP1_glutamate_receptors_like Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors Back     alignment and domain information
>cd06333 PBP1_ABC-type_HAAT_like Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids Back     alignment and domain information
>cd04509 PBP1_ABC_transporter_GCPR_C_like Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems Back     alignment and domain information
>cd06369 PBP1_GC_C_enterotoxin_receptor Ligand-binding domain of the membrane guanylyl cyclase C Back     alignment and domain information
>cd06268 PBP1_ABC_transporter_LIVBP_like Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily Back     alignment and domain information
>cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>PF04348 LppC: LppC putative lipoprotein; InterPro: IPR007443 This entry includes several bacterial outer membrane antigens, whose molecular function is unknown Back     alignment and domain information
>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed Back     alignment and domain information
>PRK10797 glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>PRK15437 histidine ABC transporter substrate-binding protein HisJ; Provisional Back     alignment and domain information
>PRK15010 ABC transporter lysine/arginine/ornithine binding periplasmic protein; Provisional Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>PF00497 SBP_bac_3: Bacterial extracellular solute-binding proteins, family 3; InterPro: IPR001638 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>PRK15007 putative ABC transporter arginine-biding protein; Provisional Back     alignment and domain information
>TIGR02995 ectoine_ehuB ectoine/hydroxyectoine ABC transporter solute-binding protein Back     alignment and domain information
>PRK11260 cystine transporter subunit; Provisional Back     alignment and domain information
>TIGR01096 3A0103s03R lysine-arginine-ornithine-binding periplasmic protein Back     alignment and domain information
>TIGR03870 ABC_MoxJ methanol oxidation system protein MoxJ Back     alignment and domain information
>PF10613 Lig_chan-Glu_bd: Ligated ion channel L-glutamate- and glycine-binding site; InterPro: IPR019594 This entry, sometimes called the S1 domain, is the luminal domain just upstream of the first, M1, transmembrane region of transmembrane ion-channel proteins, and binds L-glutamate and glycine [, ] Back     alignment and domain information
>cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems Back     alignment and domain information
>PRK10859 membrane-bound lytic transglycosylase F; Provisional Back     alignment and domain information
>cd01536 PBP1_ABC_sugar_binding_like Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>TIGR02285 conserved hypothetical protein Back     alignment and domain information
>cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily Back     alignment and domain information
>cd06300 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>COG0834 HisJ ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>TIGR03871 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associated probable ABC transporter substrate-binding protein Back     alignment and domain information
>COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>cd06325 PBP1_ABC_uncharacterized_transporter Type I periplasmic ligand-binding domain of uncharacterized ABC-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis Back     alignment and domain information
>cd00134 PBPb Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>PRK10653 D-ribose transporter subunit RbsB; Provisional Back     alignment and domain information
>cd06282 PBP1_GntR_like_2 Ligand-binding domain of putative DNA transcription repressors highly similar to that of the repressor specific for gluconate (GntR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>COG3107 LppC Putative lipoprotein [General function prediction only] Back     alignment and domain information
>smart00062 PBPb Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>cd06323 PBP1_ribose_binding Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs Back     alignment and domain information
>cd06317 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06319 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06312 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>cd06301 PBP1_rhizopine_binding_like Periplasmic binding proteins specific to rhizopines Back     alignment and domain information
>PRK10936 TMAO reductase system periplasmic protein TorT; Provisional Back     alignment and domain information
>PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A Back     alignment and domain information
>PRK09701 D-allose transporter subunit; Provisional Back     alignment and domain information
>cd01545 PBP1_SalR Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK15395 methyl-galactoside ABC transporter galactose-binding periplasmic protein MglB; Provisional Back     alignment and domain information
>cd06298 PBP1_CcpA_like Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation Back     alignment and domain information
>cd06309 PBP1_YtfQ_like Periplasmic binding domain of ABC-type YtfQ-like transport systems Back     alignment and domain information
>cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria Back     alignment and domain information
>cd06284 PBP1_LacI_like_6 Ligand-binding domain of an uncharacterized transcription regulator from Actinobacillus succinogenes and its close homologs from other bacteria Back     alignment and domain information
>cd06303 PBP1_LuxPQ_Quorum_Sensing Periplasmic binding protein (LuxP) of autoinducer-2 (AI-2) receptor LuxPQ from Vibrio harveyi and its close homologs Back     alignment and domain information
>cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species Back     alignment and domain information
>COG4623 Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01540 PBP1_arabinose_binding Periplasmic L-arabinose-binding protein (ABP), a member of a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily Back     alignment and domain information
>cd06311 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06288 PBP1_sucrose_transcription_regulator Ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06321 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>COG1879 RbsB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli Back     alignment and domain information
>cd01575 PBP1_GntR Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06322 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>TIGR01481 ccpA catabolite control protein A Back     alignment and domain information
>PF00532 Peripla_BP_1: Periplasmic binding proteins and sugar binding domain of LacI family; InterPro: IPR001761 This family includes the periplasmic binding proteins, and the LacI family transcriptional regulators Back     alignment and domain information
>cd06306 PBP1_TorT-like TorT-like proteins, a periplasmic binding protein family that activates induction of the Tor respiratory system upon trimethylamine N-oxide (TMAO) electron-acceptor binding in bacteria Back     alignment and domain information
>cd06283 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR Back     alignment and domain information
>PRK10355 xylF D-xylose transporter subunit XylF; Provisional Back     alignment and domain information
>cd06271 PBP1_AglR_RafR_like Ligand-binding domain of DNA transcription repressors specific for raffinose (RafR) and alpha-glucosides (AglR) which are members of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd01574 PBP1_LacI Ligand-binding domain of DNA transcription repressor LacI specific for lactose, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06285 PBP1_LacI_like_7 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06293 PBP1_LacI_like_11 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06324 PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06270 PBP1_GalS_like Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism Back     alignment and domain information
>cd06308 PBP1_sensor_kinase_like Periplasmic binding domain of two-component sensor kinase signaling systems Back     alignment and domain information
>cd06316 PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06274 PBP1_FruR Ligand binding domain of DNA transcription repressor specific for fructose (FruR) and its close homologs Back     alignment and domain information
>cd06281 PBP1_LacI_like_5 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PRK10703 DNA-binding transcriptional repressor PurR; Provisional Back     alignment and domain information
>cd06299 PBP1_LacI_like_13 Ligand-binding domain of DNA-binding regulatory protein from Corynebacterium glutamicum which has a unique ability to produce significant amounts of L-glutamate directly from cheap sugar and ammonia Back     alignment and domain information
>cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06295 PBP1_CelR Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional Back     alignment and domain information
>cd06278 PBP1_LacI_like_2 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PF04392 ABC_sub_bind: ABC transporter substrate binding protein; InterPro: IPR007487 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK15408 autoinducer 2-binding protein lsrB; Provisional Back     alignment and domain information
>cd06292 PBP1_LacI_like_10 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd01538 PBP1_ABC_xylose_binding Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional Back     alignment and domain information
>cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation Back     alignment and domain information
>cd06290 PBP1_LacI_like_9 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK10423 transcriptional repressor RbsR; Provisional Back     alignment and domain information
>cd06291 PBP1_Qymf_like Ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs Back     alignment and domain information
>cd06307 PBP1_uncharacterized_sugar_binding Periplasmic sugar-binding domain of uncharacterized transport systems Back     alignment and domain information
>cd06286 PBP1_CcpB_like Ligand-binding domain of a novel transcription factor implicated in catabolite repression in Bacillus and Clostridium species Back     alignment and domain information
>cd06314 PBP1_tmGBP Periplasmic sugar-binding domain of Thermotoga maritima glucose-binding protein (tmGBP) and its close homologs Back     alignment and domain information
>COG1609 PurR Transcriptional regulators [Transcription] Back     alignment and domain information
>cd06294 PBP1_ycjW_transcription_regulator_like Ligand-binding domain of uncharacterized transcription regulator ycjW which is a member of the LacI-GalR family repressors Back     alignment and domain information
>cd06313 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor Back     alignment and domain information
>cd06280 PBP1_LacI_like_4 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06272 PBP1_hexuronate_repressor_like Ligand-binding domain of DNA transcription repressor for the hexuronate utilization operon from Bacillus species and its close homologs from other bacteria, all of which are a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>TIGR02955 TMAO_TorT TMAO reductase system periplasmic protein TorT Back     alignment and domain information
>cd06354 PBP1_BmpA_PnrA_like Periplasmic binding domain of basic membrane lipoprotein, PnrA, in Treponema pallidum and its homologs from other bacteria and Archaea Back     alignment and domain information
>PRK10727 DNA-binding transcriptional regulator GalR; Provisional Back     alignment and domain information
>cd06302 PBP1_LsrB_Quorum_Sensing Periplasmic binding domain of autoinducer-2 (AI-2) receptor LsrB from Salmonella typhimurium and its close homologs Back     alignment and domain information
>cd06277 PBP1_LacI_like_1 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PRK09526 lacI lac repressor; Reviewed Back     alignment and domain information
>cd06279 PBP1_LacI_like_3 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06304 PBP1_BmpA_like Periplasmic binding component of a family of basic membrane lipoproteins from Borrelia and various putative lipoproteins from other bacteria Back     alignment and domain information
>cd06297 PBP1_LacI_like_12 Ligand-binding domain of uncharacterized transcription regulators from Thermus thermophilus and close homologs Back     alignment and domain information
>cd01541 PBP1_AraR Ligand-binding domain of DNA transcription repressor specific for arabinose (AraR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK09492 treR trehalose repressor; Provisional Back     alignment and domain information
>cd01543 PBP1_XylR Ligand-binding domain of DNA transcription repressor specific for xylose (XylR) Back     alignment and domain information
>PRK14987 gluconate operon transcriptional regulator; Provisional Back     alignment and domain information
>PRK10401 DNA-binding transcriptional regulator GalS; Provisional Back     alignment and domain information
>PRK11041 DNA-binding transcriptional regulator CytR; Provisional Back     alignment and domain information
>TIGR02405 trehalos_R_Ecol trehalose operon repressor, proteobacterial Back     alignment and domain information
>TIGR02634 xylF D-xylose ABC transporter, substrate-binding protein Back     alignment and domain information
>TIGR02637 RhaS rhamnose ABC transporter, rhamnose-binding protein Back     alignment and domain information
>cd01544 PBP1_GalR Ligand-binding domain of DNA transcription repressor GalR which is one of two regulatory proteins involved in galactose transport and metabolism Back     alignment and domain information
>cd06315 PBP1_ABC_sugar_binding_like_6 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06353 PBP1_BmpA_Med_like Periplasmic binding domain of the basic membrane lipoprotein Med in Bacillus and its close homologs from other bacteria and Archaea Back     alignment and domain information
>TIGR01098 3A0109s03R phosphate/phosphite/phosphonate ABC transporters, periplasmic binding protein Back     alignment and domain information
>TIGR02990 ectoine_eutA ectoine utilization protein EutA Back     alignment and domain information
>cd06287 PBP1_LacI_like_8 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06276 PBP1_FucR_like Ligand-binding domain of a transcription repressor, FucR, which functions as a molecular sensor of L-fucose availability Back     alignment and domain information
>COG1744 Med Uncharacterized ABC-type transport system, periplasmic component/surface lipoprotein [General function prediction only] Back     alignment and domain information
>PRK10339 DNA-binding transcriptional repressor EbgR; Provisional Back     alignment and domain information
>COG4213 XylF ABC-type xylose transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3473 Maleate cis-trans isomerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK00489 hisG ATP phosphoribosyltransferase; Reviewed Back     alignment and domain information
>PF02608 Bmp: Basic membrane protein; InterPro: IPR003760 This is a family of basic membrane lipoproteins from Borrelia and various putative lipoproteins from other bacteria Back     alignment and domain information
>COG1794 RacX Aspartate racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13377 Peripla_BP_3: Periplasmic binding protein-like domain; PDB: 3K9C_B 3BIL_B 3JVD_B 1ZAY_A 1VPW_A 1DBQ_A 2PUA_A 1QQA_A 1PNR_A 1JHZ_A Back     alignment and domain information
>TIGR00035 asp_race aspartate racemase Back     alignment and domain information
>COG1454 EutG Alcohol dehydrogenase, class IV [Energy production and conversion] Back     alignment and domain information
>PRK09860 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd06353 PBP1_BmpA_Med_like Periplasmic binding domain of the basic membrane lipoprotein Med in Bacillus and its close homologs from other bacteria and Archaea Back     alignment and domain information
>PF03808 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/CpsF family; InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli Back     alignment and domain information
>cd08192 Fe-ADH7 Iron-containing alcohol dehydrogenases-like, involved in the linear alkylbenzenesulfonate (LAS) degradation pathway Back     alignment and domain information
>PRK15454 ethanol dehydrogenase EutG; Provisional Back     alignment and domain information
>cd08190 HOT Hydroxyacid-oxoacid transhydrogenase (HOT) involved in gamma-hydroxybutyrate metabolism Back     alignment and domain information
>cd08189 Fe-ADH5 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein Back     alignment and domain information
>cd08193 HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyzes the oxidation of 5-hydroxyvalerate to 5-oxovalerate with NAD+ as cofactor Back     alignment and domain information
>PRK10624 L-1,2-propanediol oxidoreductase; Provisional Back     alignment and domain information
>cd08551 Fe-ADH iron-containing alcohol dehydrogenases (Fe-ADH)-like Back     alignment and domain information
>cd08194 Fe-ADH6 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>PRK10200 putative racemase; Provisional Back     alignment and domain information
>cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins Back     alignment and domain information
>TIGR02638 lactal_redase lactaldehyde reductase Back     alignment and domain information
>PF00465 Fe-ADH: Iron-containing alcohol dehydrogenase ; InterPro: IPR001670 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd08185 Fe-ADH1 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>PF12683 DUF3798: Protein of unknown function (DUF3798); InterPro: IPR024258 This entry represents functionally uncharacterised proteins that are found in bacteria Back     alignment and domain information
>cd08188 Fe-ADH4 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd08176 LPO Lactadehyde:propanediol oxidoreductase (LPO) catalyzes the interconversion between L-lactaldehyde and L-1,2-propanediol in Escherichia coli and other enterobacteria Back     alignment and domain information
>PF01177 Asp_Glu_race: Asp/Glu/Hydantoin racemase; InterPro: IPR015942 This entry represents a group of related proteins that includes aspartate racemase, glutamate racemase, hydantoin racemase and arylmalonate decarboxylase Back     alignment and domain information
>PRK07475 hypothetical protein; Provisional Back     alignment and domain information
>cd08181 PPD-like 1,3-propanediol dehydrogenase-like (PPD) Back     alignment and domain information
>cd08191 HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyzes the oxidation of 6-hydroxyhexanoate to 6-oxohexanoate Back     alignment and domain information
>cd08182 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) catalyzes the reduction of phosphonoacetaldehyde (PnAA) to hydroxyethylphosphoate (HEP) Back     alignment and domain information
>cd07766 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) and iron-containing alcohol dehydrogenases (Fe-ADH) Back     alignment and domain information
>cd08170 GlyDH Glycerol dehydrogenases (GlyDH) catalyzes oxidation of glycerol to dihydroxyacetone in glycerol dissmilation Back     alignment and domain information
>PF06506 PrpR_N: Propionate catabolism activator; InterPro: IPR010524 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>PF02608 Bmp: Basic membrane protein; InterPro: IPR003760 This is a family of basic membrane lipoproteins from Borrelia and various putative lipoproteins from other bacteria Back     alignment and domain information
>KOG3857 consensus Alcohol dehydrogenase, class IV [Energy production and conversion] Back     alignment and domain information
>PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A Back     alignment and domain information
>cd08186 Fe-ADH8 Iron-containing alcohol dehydrogenase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query633
2e4z_A501 Crystal Structure Of The Ligand-Binding Region Of T 4e-16
3mq4_A481 Metabotropic Glutamate Receptor Mglur7 Complexed Wi 2e-15
3kg2_A 823 Ampa Subtype Ionotropic Glutamate Receptor In Compl 6e-13
3sm9_A479 Crystal Structure Of Metabotropic Glutamate Recepto 1e-10
2e4u_A555 Crystal Structure Of The Extracellular Region Of Th 1e-10
3lmk_A492 Ligand Binding Domain Of Metabotropoc Glutamate Rec 5e-10
3q41_A384 Crystal Structure Of The Glun1 N-Terminal Domain (N 2e-08
3ks9_A496 Metabotropic Glutamate Receptor Mglur1 Complexed Wi 4e-08
1ewk_A490 Crystal Structure Of Metabotropic Glutamate Recepto 6e-08
4f11_A433 Crystal Structure Of The Extracellular Domain Of Hu 5e-07
2f34_A258 Crystal Structure Of The Glur5 Ligand Binding Core 7e-06
1txf_A258 Crystal Structure Of The Glur5 Ligand Binding Core 7e-06
2wky_A258 Crystal Structure Of The Ligand-Binding Core Of Glu 7e-06
2zns_A256 Crystal Structure Of The Ligand-Binding Core Of The 7e-06
1ycj_A257 Crystal Structure Of The Kainate Receptor Glur5 Lig 7e-06
3qxm_A258 Crystal Structure Of Human Gluk2 Ligand-Binding Cor 2e-05
1yae_A 312 Structure Of The Kainate Receptor Subunit Glur6 Ago 2e-05
2i0c_A259 Crystal Structure Of The Glur6 Ligand Binding Core 3e-05
3u92_A257 Crystal Structure Of The Gluk3 Ligand Binding Domai 4e-05
3s9e_A258 Crystal Structure Of The Kainate Receptor Gluk3 Lig 4e-05
3g3g_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 5e-05
1s50_A259 X-Ray Structure Of The Glur6 Ligand Binding Core (S 5e-05
3g3h_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 5e-05
2xxw_A261 Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Di 5e-05
2xxr_A261 Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lb 5e-05
2xxu_A261 Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Di 5e-05
3dp4_A278 Crystal Structure Of The Binding Domain Of The Ampa 6e-05
4f2o_A258 Quisqualate Bound To The D655a Mutant Of The Ligand 6e-05
3rnn_A 292 Crystal Structure Of Iglur2 Ligand Binding Domain W 6e-05
3m3f_A258 Pepa Bound To The Ligand Binding Domain Of Glua3 (F 7e-05
3lsw_A258 Aniracetam Bound To The Ligand Binding Domain Of Gl 7e-05
2xx7_A291 Crystal Structure Of 1-(4-(1-Pyrrolidinylcarbonyl)p 8e-05
4f22_A258 Kainate Bound To The K660a Mutant Of The Ligand Bin 8e-05
3rn8_A 280 Crystal Structure Of Iglur2 Ligand Binding Domain A 8e-05
3dp6_A279 Crystal Structure Of The Binding Domain Of The Ampa 8e-05
1gr2_A279 Structure Of A Glutamate Receptor Ligand Binding Co 9e-05
1mqh_A263 Crystal Structure Of The Glur2 Ligand Binding Core 9e-05
1m5d_A263 X-ray Structure Of The Glur2 Ligand Binding Core (s 9e-05
3b6w_C263 Crystal Structure Of The Glur2 Ligand Binding Core 9e-05
3b6t_A263 Crystal Structure Of The Glur2 Ligand Binding Core 9e-05
1p1n_A263 Glur2 Ligand Binding Core (S1s2j) Mutant L650t In C 1e-04
1lbc_A263 Crystal Structure Of Glur2 Ligand Binding Core (S1s 1e-04
1mqd_A261 X-Ray Structure Of The Glur2 Ligand-Binding Core (S 1e-04
3pd8_A261 X-Ray Structure Of The Ligand-Binding Core Of Glua2 1e-04
1fw0_A263 Crystal Structure Of The Glur2 Ligand Binding Core 1e-04
3t9x_B258 Glutamate Bound To A Double Cysteine Mutant (V484cE 1e-04
3pd9_A260 X-Ray Structure Of The Ligand-Binding Core Of Glua2 1e-04
3r7x_A263 Crystal Structure Analysis Of A Quinazolinedione Su 1e-04
3ijo_B258 Crystal Structure Of The Ampa Subunit Glur2 Bound T 1e-04
2i3w_A259 Measurement Of Conformational Changes Accompanying 1e-04
3h03_A258 Crystal Structure Of The Binding Domain Of The Ampa 1e-04
2i3v_A259 Measurement Of Conformational Changes Accompanying 1e-04
1lbb_A263 Crystal Structure Of The Glur2 Ligand Binding Domai 1e-04
1p1w_A263 Crystal Structure Of The Glur2 Ligand-Binding Core 1e-04
3o29_A263 Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Gl 1e-04
3o28_A263 Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Gl 1e-04
2xhd_A263 Crystal Structure Of N-((2s)-5-(6-Fluoro-3-Pyridiny 1e-04
1lb8_A263 Crystal Structure Of The Non-Desensitizing Glur2 Li 1e-04
3tdj_A263 Crystal Structure Of The Glua2 Ligand-Binding Domai 1e-04
2uxa_A261 Crystal Structure Of The Glur2-Flip Ligand Binding 1e-04
2gfe_A262 Crystal Structure Of The Glur2 A476e S673d Ligand B 1e-04
2i0b_A259 Crystal Structure Of The Glur6 Ligand Binding Core 1e-04
2anj_A263 Crystal Structure Of The Glur2 Ligand Binding Core 2e-04
3t93_B258 Glutamate Bound To A Double Cysteine Mutant (A452cS 2e-04
3en3_A257 Crystal Structure Of The Glur4 Ligand-Binding Domai 3e-04
3fat_A260 X-Ray Structure Of Iglur4 Flip Ligand-Binding Core 3e-04
3kei_A257 Crystal Structure Of The Glua4 Ligand-Binding Domai 3e-04
3g3k_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 4e-04
3g3j_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 4e-04
3g3i_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 5e-04
3h5v_A394 Crystal Structure Of The Glur2-atd Length = 394 8e-04
>pdb|2E4Z|A Chain A, Crystal Structure Of The Ligand-Binding Region Of The Group Iii Metabotropic Glutamate Receptor Length = 501 Back     alignment and structure 
Iteration: 1

 Score = 83.2 bits (204), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 102/425 (24%), Positives = 175/425 (41%), Gaps = 66/425 (15%)
Query: 61  NSNPAILGGTKLKLTVHDTNYSRFLGMVEALTLLE-----------------------NE 97
           NS+P +L    L   + DT       + ++LT ++                        +
Sbjct: 58  NSDPNLLPNVTLGARILDTCSRDTYALEQSLTFVQALIQKDTSDVRCTNGEPPVFVKPEK 117
Query: 98  TVAIIGPQFSVIAHLVSHIANEFQVPLLSFAATDPSLSS-LQYPFFVRTTQSDLYQMAAI 156
            V +IG   S ++ +V++I   FQ+P +S+A+T P LS   +Y FF R    D +Q  A+
Sbjct: 118 VVGVIGASGSSVSIMVANILRLFQIPQISYASTAPELSDDRRYDFFSRVVPPDSFQAQAM 177
Query: 157 ADIVDYFGWRNVIALYVDDDHGRNGIAALGD--KLAEKRCRLSHKVPLSPKGSRNQIIDT 214
            DIV   GW  V  L  +  +G  G+ +     K A   C ++  V + P+  +++ ID 
Sbjct: 178 VDIVKALGWNYVSTLASEGSYGEKGVESFTQISKEAGGLC-IAQSVRI-PQERKDRTIDF 235
Query: 215 LLTVSSMM----SRILILHTYDIWGLEVLNAAKHLRMMESGYVWIVTD-WLSSILDTDSQ 269
              +  ++    SR +++   D    ++L AAK    +   ++W+ +D W S I    + 
Sbjct: 236 DRIIKQLLDTPNSRAVVIFANDEDIKQILAAAKRADQV-GHFLWVGSDSWGSKI----NP 290
Query: 270 LHSEKMDDIQGVLTLRMYTQSSEE-KRKFVTRWRHLTRRN---------TLNGPIGLNSF 319
           LH  + D  +G +T++    + E     F +R     RRN           N  + ++  
Sbjct: 291 LHQHE-DIAEGAITIQPKRATVEGFDAYFTSRTLENNRRNVWFAEYWEENFNCKLTISGS 349
Query: 320 GLYAYDTLWLLAHAIG--AFFDQGGNISFSEDS------KLSELSR---GDMRFSSVSIF 368
                D        IG  + ++Q G + F  D+       L  +++    D R     + 
Sbjct: 350 KKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAHALHHMNKDLCADYRGVCPEME 409
Query: 369 N-GGKMLLDNILQVNMTGVTG-PIKFTSDRDLINP----AYEVINVIGTGSRRIGYWSNH 422
             GGK LL  I  VN  G  G P+ F  + D         Y+  N    G R IG W++ 
Sbjct: 410 QAGGKKLLKYIRHVNFNGSAGTPVMFNKNGDAPGRYDIFQYQTTNTTNPGYRLIGQWTDE 469
Query: 423 SGLSV 427
             L++
Sbjct: 470 LQLNI 474
>pdb|3MQ4|A Chain A, Metabotropic Glutamate Receptor Mglur7 Complexed With Ly3414 Antagonist Length = 481 Back     alignment and structure
>pdb|3KG2|A Chain A, Ampa Subtype Ionotropic Glutamate Receptor In Complex With Competitive Antagonist Zk 200775 Length = 823 Back     alignment and structure
>pdb|3SM9|A Chain A, Crystal Structure Of Metabotropic Glutamate Receptor 3 Precursor In Presence Of Ly341495 Antagonist Length = 479 Back     alignment and structure
>pdb|2E4U|A Chain A, Crystal Structure Of The Extracellular Region Of The Group Ii Metabotropic Glutamate Receptor Complexed With L-glutamate Length = 555 Back     alignment and structure
>pdb|3LMK|A Chain A, Ligand Binding Domain Of Metabotropoc Glutamate Receptor Mglur5 Complexed With Glutamate Length = 492 Back     alignment and structure
>pdb|3Q41|A Chain A, Crystal Structure Of The Glun1 N-Terminal Domain (Ntd) Length = 384 Back     alignment and structure
>pdb|3KS9|A Chain A, Metabotropic Glutamate Receptor Mglur1 Complexed With Ly341495 Antagonist Length = 496 Back     alignment and structure
>pdb|1EWK|A Chain A, Crystal Structure Of Metabotropic Glutamate Receptor Subtype 1 Complexed With Glutamate Length = 490 Back     alignment and structure
>pdb|4F11|A Chain A, Crystal Structure Of The Extracellular Domain Of Human Gaba(B) Receptor Gbr2 Length = 433 Back     alignment and structure
>pdb|2F34|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer With Ubp310 At 1.74 Angstroms Resolution Length = 258 Back     alignment and structure
>pdb|1TXF|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core In Complex With Glutamate At 2.1 Angstrom Resolution Length = 258 Back     alignment and structure
>pdb|2WKY|A Chain A, Crystal Structure Of The Ligand-Binding Core Of Glur5 In Complex With The Agonist 4-Ahcp Length = 258 Back     alignment and structure
>pdb|2ZNS|A Chain A, Crystal Structure Of The Ligand-Binding Core Of The Human Ionotropic Glutamate Receptor, Glur5, In Complex With Glutamate Length = 256 Back     alignment and structure
>pdb|1YCJ|A Chain A, Crystal Structure Of The Kainate Receptor Glur5 Ligand- Binding Core In Complex With (S)-Glutamate Length = 257 Back     alignment and structure
>pdb|3QXM|A Chain A, Crystal Structure Of Human Gluk2 Ligand-Binding Core In Complex With Novel Marine-Derived Toxins, Neodysiherbaine A Length = 258 Back     alignment and structure
>pdb|1YAE|A Chain A, Structure Of The Kainate Receptor Subunit Glur6 Agonist Binding Domain Complexed With Domoic Acid Length = 312 Back     alignment and structure
>pdb|2I0C|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Dimer Crosslinked By Disulfide Bonds Between Y490c And L752c At 2.25 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|3U92|A Chain A, Crystal Structure Of The Gluk3 Ligand Binding Domain Complex With Kainate And Zinc: P2221 Form Length = 257 Back     alignment and structure
>pdb|3S9E|A Chain A, Crystal Structure Of The Kainate Receptor Gluk3 Ligand Binding Domain In Complex With (S)-Glutamate Length = 258 Back     alignment and structure
>pdb|3G3G|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r Mutant With Glutamate And Nacl At 1.3 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|1S50|A Chain A, X-Ray Structure Of The Glur6 Ligand Binding Core (S1s2a) In Complex With Glutamate At 1.65 A Resolution Length = 259 Back     alignment and structure
>pdb|3G3H|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r I749l Q753k Mutant With Glutamate And Nacl At 1.5 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|2XXW|A Chain A, Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2XXR|A Chain A, Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2XXU|A Chain A, Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|3DP4|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur3 Bound To Ampa Length = 278 Back     alignment and structure
>pdb|4F2O|A Chain A, Quisqualate Bound To The D655a Mutant Of The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|3RNN|A Chain A, Crystal Structure Of Iglur2 Ligand Binding Domain With Symmetric Sulfonamide Containing Potentiator Length = 292 Back     alignment and structure
>pdb|3M3F|A Chain A, Pepa Bound To The Ligand Binding Domain Of Glua3 (Flop Form) Length = 258 Back     alignment and structure
>pdb|3LSW|A Chain A, Aniracetam Bound To The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|2XX7|A Chain A, Crystal Structure Of 1-(4-(1-Pyrrolidinylcarbonyl)phenyl)-3- (Trifluoromethyl)-4,5,6,7-Tetrahydro-1h-Indazole In Complex With The Ligand Binding Domain Of The Rat Glua2 Receptor And Glutamate At 2.2a Resolution. Length = 291 Back     alignment and structure
>pdb|4F22|A Chain A, Kainate Bound To The K660a Mutant Of The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|3RN8|A Chain A, Crystal Structure Of Iglur2 Ligand Binding Domain And Symmetrical Carboxyl Containing Potentiator Length = 280 Back     alignment and structure
>pdb|3DP6|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur2 Bound To Glutamate Length = 279 Back     alignment and structure
>pdb|1GR2|A Chain A, Structure Of A Glutamate Receptor Ligand Binding Core (Glur2) Complexed With Kainate Length = 279 Back     alignment and structure
>pdb|1MQH|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) In Complex With Bromo-Willardiine At 1.8 Angstroms Resolution Length = 263 Back     alignment and structure
>pdb|1M5D|A Chain A, X-ray Structure Of The Glur2 Ligand Binding Core (s1s2j- Y702f) In Complex With Br-hibo At 1.73 A Resolution Length = 263 Back     alignment and structure
>pdb|3B6W|C Chain C, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) T686s Mutant In Complex With Glutamate At 1.7 Resolution Length = 263 Back     alignment and structure
>pdb|3B6T|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) T686a Mutant In Complex With Quisqualate At 2.1 Resolution Length = 263 Back     alignment and structure
>pdb|1P1N|A Chain A, Glur2 Ligand Binding Core (S1s2j) Mutant L650t In Complex With Kainate Length = 263 Back     alignment and structure
>pdb|1LBC|A Chain A, Crystal Structure Of Glur2 Ligand Binding Core (S1s2j- N775s) In Complex With Cyclothiazide (Ctz) As Well As Glutamate At 1.8 A Resolution Length = 263 Back     alignment and structure
>pdb|1MQD|A Chain A, X-Ray Structure Of The Glur2 Ligand-Binding Core (S1s2j) In Complex With (S)-Des-Me-Ampa At 1.46 A Resolution. Crystallization In The Presence Of Lithium Sulfate. Length = 261 Back     alignment and structure
>pdb|3PD8|A Chain A, X-Ray Structure Of The Ligand-Binding Core Of Glua2 In Complex With (S)-7-Hpca At 2.5 A Resolution Length = 261 Back     alignment and structure
>pdb|1FW0|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) In Complex With Kainate At 2.0 A Resolution Length = 263 Back     alignment and structure
>pdb|3T9X|B Chain B, Glutamate Bound To A Double Cysteine Mutant (V484cE657C) OF THE Ligand Binding Domain Of Glua2 Length = 258 Back     alignment and structure
>pdb|3PD9|A Chain A, X-Ray Structure Of The Ligand-Binding Core Of Glua2 In Complex With (R)-5-Hpca At 2.1 A Resolution Length = 260 Back     alignment and structure
>pdb|3R7X|A Chain A, Crystal Structure Analysis Of A Quinazolinedione Sulfonamide Bound To Human Glur2: A Novel Class Of Competitive Ampa Receptor Antagonists With Oral Activity Length = 263 Back     alignment and structure
>pdb|3IJO|B Chain B, Crystal Structure Of The Ampa Subunit Glur2 Bound To The Allosteric Modulator, Althiazide Length = 258 Back     alignment and structure
>pdb|2I3W|A Chain A, Measurement Of Conformational Changes Accompanying Desensitization In An Ionotropic Glutamate Receptor: Structure Of S729c Mutant Length = 259 Back     alignment and structure
>pdb|3H03|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur2 Bound To Ubp277 Length = 258 Back     alignment and structure
>pdb|2I3V|A Chain A, Measurement Of Conformational Changes Accompanying Desensitization In An Ionotropic Glutamate Receptor: Structure Of G725c Mutant Length = 259 Back     alignment and structure
>pdb|1LBB|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Domain Mutant (s1s2j-n754d) In Complex With Kainate At 2.1 A Resolution Length = 263 Back     alignment and structure
>pdb|1P1W|A Chain A, Crystal Structure Of The Glur2 Ligand-Binding Core (S1s2j) With The L483y And L650t Mutations And In Complex With Ampa Length = 263 Back     alignment and structure
>pdb|3O29|A Chain A, Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Glutamate Receptor In Complex With An Allosteric Modulator Length = 263 Back     alignment and structure
>pdb|3O28|A Chain A, Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Glutamate Receptor In Complex With An Allosteric Modulator Length = 263 Back     alignment and structure
>pdb|2XHD|A Chain A, Crystal Structure Of N-((2s)-5-(6-Fluoro-3-Pyridinyl)-2,3- Dihydro-1h-Inden-2-Yl)-2-Propanesulfonamide In Complex With The Ligand Binding Domain Of The Human Glua2 Receptor Length = 263 Back     alignment and structure
>pdb|1LB8|A Chain A, Crystal Structure Of The Non-Desensitizing Glur2 Ligand Binding Core Mutant (S1s2j-L483y) In Complex With Ampa At 2.3 Resolution Length = 263 Back     alignment and structure
>pdb|3TDJ|A Chain A, Crystal Structure Of The Glua2 Ligand-Binding Domain (S1s2j-L483y- N754s) In Complex With Glutamate And Bpam-97 At 1.95 A Resolution Length = 263 Back     alignment and structure
>pdb|2UXA|A Chain A, Crystal Structure Of The Glur2-Flip Ligand Binding Domain, RG UNEDITED. Length = 261 Back     alignment and structure
>pdb|2GFE|A Chain A, Crystal Structure Of The Glur2 A476e S673d Ligand Binding Core Mutant At 1.54 Angstroms Resolution Length = 262 Back     alignment and structure
>pdb|2I0B|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Elkq Mutant Dimer At 1.96 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|2ANJ|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j- Y450w) Mutant In Complex With The Partial Agonist Kainic Acid At 2.1 A Resolution Length = 263 Back     alignment and structure
>pdb|3T93|B Chain B, Glutamate Bound To A Double Cysteine Mutant (A452cS652C) OF THE Ligand Binding Domain Of Glua2 Length = 258 Back     alignment and structure
>pdb|3EN3|A Chain A, Crystal Structure Of The Glur4 Ligand-Binding Domain In Complex With Kainate Length = 257 Back     alignment and structure
>pdb|3FAT|A Chain A, X-Ray Structure Of Iglur4 Flip Ligand-Binding Core (S1s2) In Complex With (S)-Ampa At 1.90a Resolution Length = 260 Back     alignment and structure
>pdb|3KEI|A Chain A, Crystal Structure Of The Glua4 Ligand-Binding Domain L651v Mutant In Complex With Glutamate Length = 257 Back     alignment and structure
>pdb|3G3K|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k E757q Mutant With Glutamate And Nacl At 1.24 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3J|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k Mutant With Glutamate And Nacl At 1.32 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3I|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e I749l Q753k Mutant With Glutamate And Nacl At 1.37 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3H5V|A Chain A, Crystal Structure Of The Glur2-atd Length = 394 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query633
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 1e-117
4f11_A433 Gamma-aminobutyric acid type B receptor subunit 2; 3e-96
3h6g_A395 Glutamate receptor, ionotropic kainate 2; membrane 8e-94
3om0_A393 Glutamate receptor, ionotropic kainate 5; membrane 4e-91
3saj_A384 Glutamate receptor 1; rossman fold, ION channel, m 4e-87
3hsy_A376 Glutamate receptor 2; ligand-gated ION channel, sy 1e-81
1jdp_A441 NPR-C, atrial natriuretic peptide clearance recept 3e-81
3o21_A389 Glutamate receptor 3; periplasmatic binding protei 5e-81
3qek_A384 NMDA glutamate receptor subunit; amino terminal do 7e-75
1dp4_A435 Atrial natriuretic peptide receptor A; periplasmic 5e-66
3qel_B364 Glutamate [NMDA] receptor subunit epsilon-2; ION c 3e-60
3mq4_A481 Mglur7, metabotropic glutamate receptor 7; glutama 8e-32
3sm9_A479 Mglur3, metabotropic glutamate receptor 3; structu 9e-32
2e4u_A555 Metabotropic glutamate receptor 3; G-protein-coupl 2e-30
3ks9_A496 Mglur1, metabotropic glutamate receptor 1; glutama 3e-30
4evq_A375 Putative ABC transporter subunit, substrate-bindi 5e-19
3lop_A364 Substrate binding periplasmic protein; protein str 5e-18
1yae_A 312 Glutamate receptor, ionotropic kainate 2; kainate 1e-17
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 2e-17
1usg_A346 Leucine-specific binding protein; leucine-binding 5e-17
1usg_A346 Leucine-specific binding protein; leucine-binding 5e-05
3ipc_A356 ABC transporter, substrate binding protein (amino; 8e-17
3ipc_A356 ABC transporter, substrate binding protein (amino; 3e-04
3lkb_A392 Probable branched-chain amino acid ABC transporter 1e-16
3i45_A387 Twin-arginine translocation pathway signal protei; 5e-16
3sg0_A386 Extracellular ligand-binding receptor; structural 2e-15
3hut_A358 Putative branched-chain amino acid ABC transporter 3e-15
3h5l_A419 Putative branched-chain amino acid ABC transporter 5e-15
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 9e-15
4eyg_A368 Twin-arginine translocation pathway signal; PSI-bi 4e-14
3snr_A362 Extracellular ligand-binding receptor; structural 1e-13
3eaf_A391 ABC transporter, substrate binding protein; PSI2, 8e-13
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 2e-12
3td9_A366 Branched chain amino acid ABC transporter, peripl 4e-12
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 1e-11
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 1e-10
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 9e-10
3i09_A375 Periplasmic branched-chain amino acid-binding Pro; 1e-09
3n0x_A374 Possible substrate binding protein of ABC transpo 2e-09
3n0w_A379 ABC branched chain amino acid family transporter, 3e-09
4f06_A371 Extracellular ligand-binding receptor; PSI-biology 7e-09
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 2e-08
1xt8_A292 Putative amino-acid transporter periplasmic solut 5e-08
2yjp_A291 Putative ABC transporter, periplasmic binding Pro 6e-08
1pea_A385 Amidase operon; gene regulator, receptor, binding 6e-08
3k4u_A245 Binding component of ABC transporter; structural g 2e-07
4eq9_A246 ABC transporter substrate-binding protein-amino A 3e-07
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 7e-07
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 1e-06
3kzg_A237 Arginine 3RD transport system periplasmic binding 2e-06
2v25_A259 Major cell-binding factor; antigen, adhesin, aspar 2e-06
2yln_A283 Putative ABC transporter, periplasmic binding Pro 2e-06
3tql_A227 Arginine-binding protein; transport and binding pr 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 3e-06
1lst_A239 Lysine, arginine, ornithine-binding protein; amino 3e-06
3hv1_A268 Polar amino acid ABC uptake transporter substrate 3e-06
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 3e-06
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 4e-06
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 4e-06
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 4e-06
2q88_A257 EHUB, putative ABC transporter amino acid-binding 6e-06
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 7e-06
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 1e-05
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 1e-05
3qax_A268 Probable ABC transporter arginine-binding protein; 2e-05
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 5e-05
2vha_A 287 Periplasmic binding transport protein; periplasmic 7e-05
3del_B242 Arginine binding protein; alpha and beta protein ( 7e-05
2o1m_A258 Probable amino-acid ABC transporter extracellular- 3e-04
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 Back     alignment and structure
 Score =  367 bits (943), Expect = e-117
 Identities = 98/623 (15%), Positives = 206/623 (33%), Gaps = 78/623 (12%)

Query: 33  LNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFLGMVEALT 92
           + IG +F   +        A    +   +++   L      L V ++    F       +
Sbjct: 3   IQIGGLFPRGA---DQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANS----FAVTNAFCS 55

Query: 93  LLENETVAIIGPQFSVIAHLVSHIANEFQVPLLSFAATDPSLSSLQYPFFVRTTQSDLYQ 152
                  AI G       + ++       V  ++ +          +PF ++        
Sbjct: 56  QFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG----THPFVIQMRPD---L 108

Query: 153 MAAIADIVDYFGWRNVIALYVDDDHGRNGIAALGDKLAEKRCRLSHK--VPLSPKGSRNQ 210
             A+  +++Y+ W     LY D D G + + A+ D  AEK+ +++      ++       
Sbjct: 109 KGALLSLIEYYQWDKFAYLY-DSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDET 167

Query: 211 IIDTLLTVSSMMSRILILHTYDIWGLEVLNAAKHLRMMESGYVWIVTDWLSSILDTDSQL 270
                  +     R +IL        ++++    +     GY +I+ +   +  D     
Sbjct: 168 YRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQ 227

Query: 271 HSEKMDDIQGVLTLRMYTQSSEEKRKFVTRWRHLTRR-NTLNGPIGLNSFGLYAYDTLWL 329
                     V   ++         KF+ RW  L  +         +       YD + +
Sbjct: 228 FGGAE-----VSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQV 282

Query: 330 LAHAIGAFFDQGGNISFSEDSKLSELSRGDMRFSSVSIFNGGKMLLDNILQVNMTGVTGP 389
           +  A      Q   IS   ++       GD   +    +  G  +   + QV + G++G 
Sbjct: 283 MTEAFRNLRKQRIEISRRGNA-------GDCLANPAVPWGQGVEIERALKQVQVEGLSGN 335

Query: 390 IKFTSDRDLINPAYEVINVIGTGSRRIGYWSNHSGLSVVPPEALYKEPSNRSASSQHLYS 449
           IKF  +   IN    ++ +   G R+IGYWS    + +   +         S   Q    
Sbjct: 336 IKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVLTEDD--------TSGLEQKTVV 387

Query: 450 AVWPGQTTQKPRGWVFPNNGRHLRIGVPSQVIYPEFVAQGKGTDKFSGYCIDVFTAVLEL 509
                   + P   +  N+                      G +++ GYC+D+   + + 
Sbjct: 388 VTTIL---ESPYVMMKANHA------------------ALAGNERYEGYCVDLAAEIAKH 426

Query: 510 LPYAVPYKLVPFGD-GHNSPKRF---DLLRLVSEEVYDAAVGDFAITTERTKMVDFTQPY 565
             +     +V  G  G           ++  +     D A+    IT  R +++DF++P+
Sbjct: 427 CGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPF 486

Query: 566 IESGL-VVVAPIKKLNSNAWAFLNPFTPKMWCVTGIFFLVVGVVVWILEH---------- 614
           +  G+ +++   +K     ++FL+P   ++W      ++ V VV++++            
Sbjct: 487 MSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEE 546

Query: 615 ----RLNDDFRGPPRRQIGTILW 633
               R            I   LW
Sbjct: 547 FEDGRETQSSESTNEFGIFNSLW 569
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Length = 433 Back     alignment and structure
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Length = 395 Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Length = 393 Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Length = 384 Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Length = 376 Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Length = 441 Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Length = 389 Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Length = 384 Back     alignment and structure
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Length = 435 Back     alignment and structure
>3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Length = 364 Back     alignment and structure
>3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} PDB: 2e4z_A* Length = 481 Back     alignment and structure
>3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} Length = 479 Back     alignment and structure
>2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* Length = 555 Back     alignment and structure
>3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* Length = 496 Back     alignment and structure
>4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A Length = 375 Back     alignment and structure
>3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} Length = 364 Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Length = 312 Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Length = 259 Back     alignment and structure
>1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A Length = 346 Back     alignment and structure
>1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A Length = 346 Back     alignment and structure
>3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A Length = 356 Back     alignment and structure
>3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A Length = 356 Back     alignment and structure
>3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} Length = 392 Back     alignment and structure
>3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} Length = 387 Back     alignment and structure
>3sg0_A Extracellular ligand-binding receptor; structural genomics, PSI-biology; HET: 173; 1.20A {Rhodopseudomonas palustris} PDB: 4dqd_A* Length = 386 Back     alignment and structure
>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} Length = 358 Back     alignment and structure
>3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} Length = 419 Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Length = 265 Back     alignment and structure
>4eyg_A Twin-arginine translocation pathway signal; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: VNL; 1.86A {Rhodopseudomonas palustris} PDB: 4ey3_A* 3t0n_A* 4eyk_A* Length = 368 Back     alignment and structure
>3eaf_A ABC transporter, substrate binding protein; PSI2, NYSGXRC, substrate binding P structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} Length = 391 Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Length = 263 Back     alignment and structure
>3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} Length = 366 Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Length = 294 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Length = 292 Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Length = 284 Back     alignment and structure
>3i09_A Periplasmic branched-chain amino acid-binding Pro; type I periplasmic binding protein, structural genomics, JOI for structural genomics; HET: MSE CIT; 1.80A {Burkholderia mallei} Length = 375 Back     alignment and structure
>3n0x_A Possible substrate binding protein of ABC transpo system; receptor family ligand binding region, structural genomics; HET: MSE; 1.50A {Rhodopseudomonas palustris} PDB: 3nnd_B Length = 374 Back     alignment and structure
>3n0w_A ABC branched chain amino acid family transporter, periplasmic ligand binding protein...; receptor family ligand binding region; HET: MSE; 1.88A {Burkholderia xenovorans} Length = 379 Back     alignment and structure
>4f06_A Extracellular ligand-binding receptor; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: MSE PHB; 1.30A {Rhodopseudomonas palustris} PDB: 4evs_A* Length = 371 Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Length = 271 Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solut protein; ABC transport, cysteine uptake; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Length = 292 Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Length = 291 Back     alignment and structure
>1pea_A Amidase operon; gene regulator, receptor, binding protein; 2.10A {Pseudomonas aeruginosa} SCOP: c.93.1.1 PDB: 1qo0_A 1qnl_A Length = 385 Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} Length = 245 Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Length = 246 Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Length = 239 Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Length = 228 Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} Length = 237 Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Length = 259 Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Length = 283 Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} Length = 227 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} Length = 232 Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Length = 239 Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Length = 268 Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Length = 229 Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Length = 226 Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Length = 272 Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Length = 249 Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Length = 257 Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Length = 233 Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Length = 259 Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} Length = 234 Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Length = 268 Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Length = 267 Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Length = 287 Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} Length = 242 Back     alignment and structure
>2o1m_A Probable amino-acid ABC transporter extracellular-binding protein YTMK; NESG X-RAY O34852 YTMK_bacsu, structural genomics, PSI-2; 2.00A {Bacillus subtilis} Length = 258 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query633
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 100.0
3o21_A389 Glutamate receptor 3; periplasmatic binding protei 100.0
4gpa_A389 Glutamate receptor 4; PBP fold, ligand-gated ION c 100.0
3om0_A393 Glutamate receptor, ionotropic kainate 5; membrane 100.0
4f11_A433 Gamma-aminobutyric acid type B receptor subunit 2; 100.0
3h6g_A395 Glutamate receptor, ionotropic kainate 2; membrane 100.0
3hsy_A376 Glutamate receptor 2; ligand-gated ION channel, sy 100.0
3saj_A384 Glutamate receptor 1; rossman fold, ION channel, m 100.0
2e4u_A555 Metabotropic glutamate receptor 3; G-protein-coupl 100.0
3sm9_A479 Mglur3, metabotropic glutamate receptor 3; structu 100.0
1dp4_A435 Atrial natriuretic peptide receptor A; periplasmic 100.0
1jdp_A441 NPR-C, atrial natriuretic peptide clearance recept 100.0
3qek_A384 NMDA glutamate receptor subunit; amino terminal do 100.0
3ks9_A496 Mglur1, metabotropic glutamate receptor 1; glutama 100.0
3mq4_A481 Mglur7, metabotropic glutamate receptor 7; glutama 100.0
3i45_A387 Twin-arginine translocation pathway signal protei; 100.0
3qel_B364 Glutamate [NMDA] receptor subunit epsilon-2; ION c 100.0
3h5l_A419 Putative branched-chain amino acid ABC transporter 100.0
4f06_A371 Extracellular ligand-binding receptor; PSI-biology 100.0
3ipc_A356 ABC transporter, substrate binding protein (amino; 100.0
3td9_A366 Branched chain amino acid ABC transporter, peripl 100.0
3hut_A358 Putative branched-chain amino acid ABC transporter 100.0
4gnr_A353 ABC transporter substrate-binding protein-branche 100.0
1usg_A346 Leucine-specific binding protein; leucine-binding 100.0
3i09_A375 Periplasmic branched-chain amino acid-binding Pro; 100.0
3lkb_A392 Probable branched-chain amino acid ABC transporter 100.0
4evq_A375 Putative ABC transporter subunit, substrate-bindi 100.0
3n0w_A379 ABC branched chain amino acid family transporter, 100.0
3eaf_A391 ABC transporter, substrate binding protein; PSI2, 100.0
4eyg_A368 Twin-arginine translocation pathway signal; PSI-bi 100.0
3lop_A364 Substrate binding periplasmic protein; protein str 100.0
3n0x_A374 Possible substrate binding protein of ABC transpo 100.0
3sg0_A386 Extracellular ligand-binding receptor; structural 100.0
1pea_A385 Amidase operon; gene regulator, receptor, binding 100.0
3snr_A362 Extracellular ligand-binding receptor; structural 100.0
2h4a_A325 YRAM (HI1655); perplasmic binding protein, lipopro 99.95
3ckm_A327 YRAM (HI1655), LPOA; periplasmic-binding protein, 99.95
1yae_A 312 Glutamate receptor, ionotropic kainate 2; kainate 99.49
4gvo_A243 LMO2349 protein; structural genomics, IDP05245, L- 99.45
4h5g_A243 Amino acid ABC superfamily ATP binding cassette tr 99.4
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 99.4
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 99.39
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 99.32
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 99.31
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 99.31
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 99.31
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 99.29
3kzg_A237 Arginine 3RD transport system periplasmic binding 99.28
3tql_A227 Arginine-binding protein; transport and binding pr 99.25
3k4u_A245 Binding component of ABC transporter; structural g 99.23
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 99.23
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 99.23
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 99.22
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 99.2
3hv1_A268 Polar amino acid ABC uptake transporter substrate 99.2
1lst_A239 Lysine, arginine, ornithine-binding protein; amino 99.19
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 99.19
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 99.19
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 99.17
4eq9_A246 ABC transporter substrate-binding protein-amino A 99.16
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 99.16
3del_B242 Arginine binding protein; alpha and beta protein ( 99.15
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 99.14
2q88_A257 EHUB, putative ABC transporter amino acid-binding 99.12
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 99.01
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 98.98
2vha_A 287 Periplasmic binding transport protein; periplasmic 98.98
3qax_A268 Probable ABC transporter arginine-binding protein; 98.91
1xt8_A292 Putative amino-acid transporter periplasmic solut 98.9
4i62_A269 Amino acid ABC transporter, periplasmic amino ACI 98.89
2yln_A283 Putative ABC transporter, periplasmic binding Pro 98.88
2yjp_A291 Putative ABC transporter, periplasmic binding Pro 98.88
2v25_A259 Major cell-binding factor; antigen, adhesin, aspar 98.8
3ksm_A276 ABC-type sugar transport system, periplasmic COMP; 98.6
2h3h_A313 Sugar ABC transporter, periplasmic sugar-binding p 98.58
3brq_A296 HTH-type transcriptional regulator ASCG; transcrip 98.53
3brs_A289 Periplasmic binding protein/LACI transcriptional; 98.49
1dbq_A289 Purine repressor; transcription regulation, DNA-bi 98.46
3gbv_A304 Putative LACI-family transcriptional regulator; NY 98.44
2qu7_A288 Putative transcriptional regulator; structural gen 98.44
3d02_A303 Putative LACI-type transcriptional regulator; peri 98.44
2rjo_A332 Twin-arginine translocation pathway signal protei; 98.44
3l49_A291 ABC sugar (ribose) transporter, periplasmic substr 98.42
3rot_A297 ABC sugar transporter, periplasmic sugar binding; 98.4
2qh8_A302 Uncharacterized protein; conserved domain protein, 98.39
2fvy_A309 D-galactose-binding periplasmic protein; periplasm 98.36
3c3k_A285 Alanine racemase; structural genomics, protein str 98.35
1tjy_A316 Sugar transport protein; protein-ligand complex, s 98.34
3g1w_A305 Sugar ABC transporter; sugar-binding protein, baci 98.34
2fn9_A290 Ribose ABC transporter, periplasmic ribose-bindin; 98.33
3l6u_A293 ABC-type sugar transport system periplasmic compo; 98.33
3lkv_A302 Uncharacterized conserved domain protein; ATPase b 98.32
2fep_A289 Catabolite control protein A; CCPA, transcriptiona 98.32
2x7x_A325 Sensor protein; transferase, sensor histidine kina 98.3
2vk2_A306 YTFQ, ABC transporter periplasmic-binding protein 98.3
2ioy_A283 Periplasmic sugar-binding protein; ribose binding 98.29
2iks_A293 DNA-binding transcriptional dual regulator; escher 98.29
3o74_A272 Fructose transport system repressor FRUR; dual tra 98.28
2h0a_A276 TTHA0807, transcriptional regulator; repressor, st 98.26
3lft_A295 Uncharacterized protein; ABC, ATPase, cassette, L- 98.26
3h75_A350 Periplasmic sugar-binding domain protein; protein 98.25
3o1i_D304 Periplasmic protein TORT; ligand free, two compone 98.25
3d8u_A275 PURR transcriptional regulator; APC91343.1, vibrio 98.25
2rgy_A290 Transcriptional regulator, LACI family; 11011J, NY 98.25
2o20_A332 Catabolite control protein A; CCPA, transcriptiona 98.24
3dbi_A338 Sugar-binding transcriptional regulator, LACI FAM; 98.24
3k4h_A292 Putative transcriptional regulator; structural gen 98.24
1jx6_A342 LUXP protein; protein-ligand complex, signaling pr 98.21
3clk_A290 Transcription regulator; 11017J, PSI-II, NYSGXRC, 98.21
3bbl_A287 Regulatory protein of LACI family; protein structu 98.2
1qpz_A340 PURA, protein (purine nucleotide synthesis repress 98.19
8abp_A306 L-arabinose-binding protein; binding proteins; HET 98.19
3gv0_A288 Transcriptional regulator, LACI family; transcript 98.15
3hcw_A295 Maltose operon transcriptional repressor; RNA-bind 98.13
3ctp_A330 Periplasmic binding protein/LACI transcriptional; 98.11
2hsg_A332 Glucose-resistance amylase regulator; CCPA, transc 98.11
3egc_A291 Putative ribose operon repressor; structural genom 98.11
3gyb_A280 Transcriptional regulators (LACI-family transcript 98.1
3m9w_A313 D-xylose-binding periplasmic protein; xylose bindi 98.09
3jy6_A276 Transcriptional regulator, LACI family; NYSGXRC, P 98.07
3kjx_A344 Transcriptional regulator, LACI family; LACL famil 98.06
3g85_A289 Transcriptional regulator (LACI family); transcrip 98.04
3k9c_A289 Transcriptional regulator, LACI family protein; PS 98.04
3tb6_A298 Arabinose metabolism transcriptional repressor; tr 98.01
3qk7_A294 Transcriptional regulators; structural genomics, N 97.99
3kke_A303 LACI family transcriptional regulator; structural 97.96
2dri_A271 D-ribose-binding protein; sugar transport; HET: RI 97.92
3cs3_A277 Sugar-binding transcriptional regulator, LACI FAM; 97.91
3bil_A348 Probable LACI-family transcriptional regulator; st 97.9
3e3m_A355 Transcriptional regulator, LACI family; structural 97.88
1byk_A255 Protein (trehalose operon repressor); LACI family, 97.87
3e61_A277 Putative transcriptional repressor of ribose OPER; 97.84
1gud_A288 ALBP, D-allose-binding periplasmic protein; peripl 97.83
3h5o_A339 Transcriptional regulator GNTR; transcription regu 97.82
3huu_A305 Transcription regulator like protein; PSI-II, NYSG 97.81
3uug_A330 Multiple sugar-binding periplasmic receptor CHVE; 97.8
3hs3_A277 Ribose operon repressor; PSI-II, NYSGXRC, periplas 97.79
2fqx_A318 Membrane lipoprotein TMPC; ABC transport system, l 97.73
4fe7_A412 Xylose operon regulatory protein; HTH_ARAC, helix- 97.73
1jye_A349 Lactose operon repressor; gene regulation, protein 97.68
3jvd_A333 Transcriptional regulators; structural genomics, P 97.67
3miz_A301 Putative transcriptional regulator protein, LACI f 97.6
3s99_A356 Basic membrane lipoprotein; ssgcid, structural gen 97.51
2hqb_A296 Transcriptional activator of COMK gene; berkeley s 97.49
2ozz_A231 Hypothetical protein YHFZ; alpha-beta structure, s 97.34
3qi7_A371 Putative transcriptional regulator; periplasmic bi 97.13
3h5t_A366 Transcriptional regulator, LACI family; DNA-depend 97.03
3ixl_A240 Amdase, arylmalonate decarboxylase; enantioselecti 96.9
2xed_A273 Putative maleate isomerase; nicotinic acid catabol 95.12
3n5l_A 310 Binding protein component of ABC phosphonate TRAN; 94.89
3p7i_A 321 PHND, subunit of alkylphosphonate ABC transporter; 94.22
2dgd_A223 223AA long hypothetical arylmalonate decarboxylas; 92.31
1jfl_A228 Aspartate racemase; alpha-beta structure, HOMO-dim 91.53
2eq5_A228 228AA long hypothetical hydantoin racemase; struct 90.99
2fqx_A318 Membrane lipoprotein TMPC; ABC transport system, l 90.26
3bfj_A387 1,3-propanediol oxidoreductase; opportunistic path 89.37
3s99_A356 Basic membrane lipoprotein; ssgcid, structural gen 89.34
3ix1_A 302 N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine 88.99
3ox4_A383 Alcohol dehydrogenase 2; iron, NAD, oxidoreductase 88.55
2hqb_A296 Transcriptional activator of COMK gene; berkeley s 86.35
2q5c_A196 NTRC family transcriptional regulator; structural 85.59
1rrm_A386 Lactaldehyde reductase; structural genomics, dehyd 84.65
2zsk_A226 PH1733, 226AA long hypothetical aspartate racemase 83.87
1vlj_A407 NADH-dependent butanol dehydrogenase; TM0820, stru 83.78
1o2d_A371 Alcohol dehydrogenase, iron-containing; TM0920, st 83.42
3qsl_A 346 Putative exported protein; unknown, structural gen 83.02
2l82_A162 Designed protein OR32; structural genomics, northe 82.86
4ddd_A 327 Immunogenic protein; ssgcid, structural genomics, 82.72
2x26_A 308 Periplasmic aliphatic sulphonates-binding protein; 82.72
2gzm_A267 Glutamate racemase; enzyme, isomerase; HET: DGL; 1 81.66
2oho_A273 Glutamate racemase; isomerase; 2.25A {Streptococcu 81.57
3uif_A 348 Sulfonate ABC transporter, periplasmic sulfonate- 80.08
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
Probab=100.00  E-value=1.9e-67  Score=602.30  Aligned_cols=526  Identities=17%  Similarity=0.296  Sum_probs=439.5

Q ss_pred             CeEEEEEEeecCCccchhHHHHHHHHHHHHhcCCCCCCCcEEEEEEecCCC-ChHHHHHHHHHHHhcCceEEEcCCchhh
Q 006727           31 PVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNY-SRFLGMVEALTLLENETVAIIGPQFSVI  109 (633)
Q Consensus        31 ~~i~IG~l~p~~~~~g~~~~~a~~~Ave~iN~~~~il~g~~l~~~~~D~~~-~~~~a~~~~~~li~~~v~aviG~~~s~~  109 (633)
                      ++|+||+++|++..   ....|+++|+|+||+++     ++|+++++|+++ ++..+.+++|++++++|.+||||.+|..
T Consensus         1 ~~ikIG~l~~~tg~---~~~~a~~lAveeiN~~~-----~~l~~~~~D~~~~~~~~a~~~~~~l~~~~V~aiiG~~~S~~   72 (823)
T 3kg2_A            1 NSIQIGGLFPRGAD---QEYSAFRVGMVQFSTSE-----FRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKS   72 (823)
T ss_dssp             CEEEEEEEEETTCH---HHHHHHHHHHHHTCCSS-----CEEEEEEEEECTTCHHHHHHHHHHHHHTTCSEEEECCCTTT
T ss_pred             CcceEEEEeCCCCh---HHHHHHHHHHHHHhcCC-----eEEEEEEEEcCCCChHHHHHHHHHHHhcCcEEEEcCCChhH
Confidence            37999999999854   78999999999999985     899999999999 9999999999999999999999999999


Q ss_pred             HHHHHHhhccCCccEEeeccCCCCCccCCCCceEEecCChHHHHHHHHHHHHHcCCcEEEEEEecCCCcchhHHHHHHHH
Q 006727          110 AHLVSHIANEFQVPLLSFAATDPSLSSLQYPFFVRTTQSDLYQMAAIADIVDYFGWRNVIALYVDDDHGRNGIAALGDKL  189 (633)
Q Consensus       110 ~~~va~~~~~~~iP~Is~~a~~~~ls~~~~~~~~r~~p~~~~~~~al~~ll~~~~w~~v~ii~~d~~~g~~~~~~~~~~~  189 (633)
                      +.++++++..+++|+|++.  .+..  ..++|+||+.|+   ++.+++++++++||++|++|| |++||....+.+++.+
T Consensus        73 ~~a~~~i~~~~~iP~is~~--~~~~--~~~~~~~r~~p~---~~~a~~~l~~~~gw~~v~ii~-d~~~g~~~~~~~~~~~  144 (823)
T 3kg2_A           73 VNTITSFCGTLHVSFITPS--FPTD--GTHPFVIQMRPD---LKGALLSLIEYYQWDKFAYLY-DSDRGLSTLQAVLDSA  144 (823)
T ss_dssp             HHHHHHHHHHTTCEEEECS--CCCS--SCCSSEEECSCC---CHHHHHHHHHHTTCSEEEEEE-CGGGCTHHHHHHHHHH
T ss_pred             HHHHHHHhhcCCCceeecc--cCCC--CCCceEEEeCCC---HHHHHHHHHHHCCCCEEEEEE-eCChhHHHHHHHHHHh
Confidence            9999999999999999973  3322  357899999999   789999999999999999999 7789999999999999


Q ss_pred             hhcCcEEEEEeecCCC--CChhhHHHHHHHhhcCCCeEEEEeeChHHHHHHHHHHHHcCCCCCCeEEEEeCccccccCCC
Q 006727          190 AEKRCRLSHKVPLSPK--GSRNQIIDTLLTVSSMMSRILILHTYDIWGLEVLNAAKHLRMMESGYVWIVTDWLSSILDTD  267 (633)
Q Consensus       190 ~~~g~~v~~~~~~~~~--~~~~~~~~~l~~i~~~~~~vIvl~~~~~~~~~il~~a~~~g~~~~~~~~i~~~~~~~~~~~~  267 (633)
                      ++.|++|+..+.++..  .+..+++.++++++++++|+|++++...++..++++|+++|++.++|+|+.++......+. 
T Consensus       145 ~~~g~~v~~~~~~~~~~~~~~~d~~~~l~~i~~~~~~vii~~~~~~~~~~~~~~a~~~g~~~~~~~~i~~~~~~~~~~~-  223 (823)
T 3kg2_A          145 AEKKWQVTAINVGNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDL-  223 (823)
T ss_dssp             HHTTCEEEEEECSSCCSSSTTTTTTTHHHHTTTTTCCEEEEECCHHHHHHHHHHHHHHTTTBTTCEEEECSSBSSSSCC-
T ss_pred             hccCCceEEEEeecCCCCccchhHHHHHHHHHhcCCeEEEEECCHHHHHHHHHHHHHcCcCCCCeEEEEecccccccch-
Confidence            9999999998877643  2368899999999999999999999999999999999999999999999999854332222 


Q ss_pred             ccccccccccccceEEEeeecCCChHHHHHHHHHHHhhccC-CCCCCCCCCchhHHHhhHHHHHHHHHHHhhhcCCCccc
Q 006727          268 SQLHSEKMDDIQGVLTLRMYTQSSEEKRKFVTRWRHLTRRN-TLNGPIGLNSFGLYAYDTLWLLAHAIGAFFDQGGNISF  346 (633)
Q Consensus       268 ~~~~~~~~~~~~g~~~~~~~~~~~~~~~~f~~~~~~~~~~~-~~~~~~~~~~~~~~~yDav~~~~~Al~~~~~~~~~~~~  346 (633)
                          .+......|++++.+..++.+.+++|.++|+++++.. +......++.+++++|||++++++|+++++.++.....
T Consensus       224 ----~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~a~~~YDAv~~la~Al~~~~~~~~~~~~  299 (823)
T 3kg2_A          224 ----LKIQFGGAEVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLRKQRIEISR  299 (823)
T ss_dssp             ----SSSSSSBCEEEEEESSCTTSHHHHHHHHHHTTSCTTTSTTCCSSCCCHHHHHHHHHHHHHHHHHHHHHTTTCCCCC
T ss_pred             ----HHhhcCCCCceEeeeecCCchHHHHHHHHHHhhcccccCCCCccccchhhHHHHHHHHHHHHHHHHHHhhcccccc
Confidence                2233455678899988999999999999999888642 33333456788999999999999999999876554321


Q ss_pred             ccCcccccccCCCcccccc--cccCchHHHHHHHHhccccccccceEEccCCCCCCCcEEEEEeecCCeeEEeeecCCCC
Q 006727          347 SEDSKLSELSRGDMRFSSV--SIFNGGKMLLDNILQVNMTGVTGPIKFTSDRDLINPAYEVINVIGTGSRRIGYWSNHSG  424 (633)
Q Consensus       347 ~~~~~~~~~~~~~~~c~~~--~~~~~~~~l~~~l~~~~f~g~~G~v~Fd~~g~r~~~~~~I~~~~~~~~~~vg~w~~~~~  424 (633)
                      +         ....+|...  ..|.++..+.++|++++|+|++|++.||++|++....|+|++++++++.+||.|++..|
T Consensus       300 ~---------~~~~~c~~~~~~~~~~g~~l~~~l~~~~f~G~tG~i~fd~~G~~~~~~~~I~~~~~~g~~~vg~w~~~~g  370 (823)
T 3kg2_A          300 R---------GNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDK  370 (823)
T ss_dssp             S---------SCCCCTTCSSCCCCTHHHHHHHHHTTCCCEETTEECCBCSSSCBCSCEEEEEEECSSCEEEEEEEETTTE
T ss_pred             C---------CCCCCccCCCCCcccchHHHHHHHHhcccCCcccCeEECCCCcccccEEEEEEEcCCCCeeEEEEcCCCC
Confidence            1         123345543  56778999999999999999999999999999999999999999999999999998876


Q ss_pred             CcccCCccccCCCCCCCCCccccceeeeCCCCCCCCCcccccCCCceEEEEecCCCCCcCcEEec------CCCCceeee
Q 006727          425 LSVVPPEALYKEPSNRSASSQHLYSAVWPGQTTQKPRGWVFPNNGRHLRIGVPSQVIYPEFVAQG------KGTDKFSGY  498 (633)
Q Consensus       425 l~~~~~~~~~~~~~~~~~~~~~~~~i~w~g~~~~~p~~~~~~~~~~~l~v~~~~~~~~~p~~~~~------~~~~~~~G~  498 (633)
                      +....+                            ..    ...++++|+|++.   .++||.+..      .+++++.||
T Consensus       371 ~~~~~~----------------------------~~----~~~~~~~l~v~~~---~~~P~~~~~~~~~~~~~~~~~~G~  415 (823)
T 3kg2_A          371 MVLTED----------------------------DT----SGLEQKTVVVTTI---LESPYVMMKANHAALAGNERYEGY  415 (823)
T ss_dssp             EEECCC----------------------------CC----SSCCCCCEEEEEC---CCTTTSEECTTGGGCCGGGGEESH
T ss_pred             ceeccC----------------------------cc----cccCCCEEEEEEe---cCCCcEEEecCccccCCCCceEEE
Confidence            543210                            00    1235789999997   567887763      246789999


Q ss_pred             eHHHHHHHHHHCCCccceEEEeCCCCC------CCCCHHhHHHHHHcCcccEEEeeeEeeccccceeeeccceeecceEE
Q 006727          499 CIDVFTAVLELLPYAVPYKLVPFGDGH------NSPKRFDLLRLVSEEVYDAAVGDFAITTERTKMVDFTQPYIESGLVV  572 (633)
Q Consensus       499 ~vdl~~~ia~~l~~~~~~~~~~~~~~~------~~~~~~~~~~~l~~~~~d~~~~~~~~~~~r~~~~~fs~p~~~~~~~~  572 (633)
                      |+||++++++++|++  ++++...+++      .|++|++++++|.+|++|++++++++|++|.+.+|||.||+..++++
T Consensus       416 ~~dl~~~~a~~l~~~--~~~~~~~~~~~g~~~~~~g~~~~~~~~l~~~~~D~~~~~~~~t~~R~~~~dfs~py~~~~~~~  493 (823)
T 3kg2_A          416 CVDLAAEIAKHCGFK--YKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISI  493 (823)
T ss_dssp             HHHHHHHHHHHHTCC--EEEEECSSCCCCCBCTTTCCBCHHHHHHHTTSCSEECSCCBCCHHHHTTEEECSCSEEECEEE
T ss_pred             HHHHHHHHHHHcCCc--EEEEEccCCcccccCCCCCchhhHHHhhccccCcEEecceecchhheeeEEeccchhhCCEEE
Confidence            999999999999988  5555444322      56789999999999999999999999999999999999999999999


Q ss_pred             EEecCC-CCcCccccccCCchhHHHHHHHHHHHHHHHhhhhhcccCCCCCCC
Q 006727          573 VAPIKK-LNSNAWAFLNPFTPKMWCVTGIFFLVVGVVVWILEHRLNDDFRGP  623 (633)
Q Consensus       573 lv~~~~-~~~~~~~~l~pf~~~~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~  623 (633)
                      +++++. ...+++.|++||+..+|++++++++++++++|+++|++|.+|+.+
T Consensus       494 ~v~~~~~~~~~~~~fl~Pf~~~vW~~i~~~~~~~~~~l~~~~~~~p~~w~~~  545 (823)
T 3kg2_A          494 MIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTE  545 (823)
T ss_dssp             EEECCCCCCCCGGGTTTTSCHHHHHHHHHHHHHHHTTGGGTC----------
T ss_pred             EEECCCcccccchHhhcCCchhHHHHHHHHHHHHHHHHHHHHhcChhhccCc
Confidence            999887 457789999999999999999999999999999999988877643
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Back     alignment and structure
>4gpa_A Glutamate receptor 4; PBP fold, ligand-gated ION channel, ION transport, transmembrane AMPA receptor regulating proteins, cornichons, ckamp44; HET: NAG; 2.25A {Rattus norvegicus} Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Back     alignment and structure
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Back     alignment and structure
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Back     alignment and structure
>2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* Back     alignment and structure
>3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} Back     alignment and structure
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Back     alignment and structure
>3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} SCOP: c.93.1.1 PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* Back     alignment and structure
>3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} SCOP: c.93.1.0 PDB: 2e4z_A* Back     alignment and structure
>3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} Back     alignment and structure
>3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Back     alignment and structure
>3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} Back     alignment and structure
>4f06_A Extracellular ligand-binding receptor; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: MSE PHB; 1.30A {Rhodopseudomonas palustris} PDB: 4evs_A* Back     alignment and structure
>3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A Back     alignment and structure
>3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} Back     alignment and structure
>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>4gnr_A ABC transporter substrate-binding protein-branche amino acid transport; amino acid-binding protein, surface-exposed protein; HET: MLY; 1.00A {Streptococcus pneumoniae} Back     alignment and structure
>1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A Back     alignment and structure
>3i09_A Periplasmic branched-chain amino acid-binding Pro; type I periplasmic binding protein, structural genomics, JOI for structural genomics; HET: MSE CIT; 1.80A {Burkholderia mallei} Back     alignment and structure
>3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} Back     alignment and structure
>4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A Back     alignment and structure
>3n0w_A ABC branched chain amino acid family transporter, periplasmic ligand binding protein...; receptor family ligand binding region; HET: MSE; 1.88A {Burkholderia xenovorans} Back     alignment and structure
>3eaf_A ABC transporter, substrate binding protein; PSI2, NYSGXRC, substrate binding P structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} Back     alignment and structure
>4eyg_A Twin-arginine translocation pathway signal; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: VNL; 1.86A {Rhodopseudomonas palustris} PDB: 4ey3_A* 3t0n_A* 4eyk_A* Back     alignment and structure
>3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} Back     alignment and structure
>3n0x_A Possible substrate binding protein of ABC transpo system; receptor family ligand binding region, structural genomics; HET: MSE; 1.50A {Rhodopseudomonas palustris} PDB: 3nnd_B Back     alignment and structure
>3sg0_A Extracellular ligand-binding receptor; structural genomics, PSI-biology; HET: 173; 1.20A {Rhodopseudomonas palustris} PDB: 4dqd_A* Back     alignment and structure
>1pea_A Amidase operon; gene regulator, receptor, binding protein; 2.10A {Pseudomonas aeruginosa} SCOP: c.93.1.1 PDB: 1qo0_A 1qnl_A Back     alignment and structure
>3ckm_A YRAM (HI1655), LPOA; periplasmic-binding protein, lipoprotein, unliganded, biosynthetic protein; 1.35A {Haemophilus influenzae} SCOP: c.93.1.1 Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Back     alignment and structure
>4gvo_A LMO2349 protein; structural genomics, IDP05245, L-cystine, ABC transporter, periplasmic binding protein, niaid; HET: HIS; 1.45A {Listeria monocytogenes} PDB: 2o1m_A Back     alignment and structure
>4h5g_A Amino acid ABC superfamily ATP binding cassette transporter, binding protein; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: ARG; 1.78A {Streptococcus pneumoniae} PDB: 4h5f_A* Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} SCOP: c.94.1.0 Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} SCOP: c.94.1.0 Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} SCOP: c.94.1.0 Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} SCOP: c.94.1.0 Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} SCOP: c.94.1.0 Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} SCOP: c.94.1.0 Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solut protein; ABC transport, cysteine uptake; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Back     alignment and structure
>4i62_A Amino acid ABC transporter, periplasmic amino ACI protein, putative; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases (NIAI niaid; HET: ARG; 1.05A {Streptococcus pneumoniae} Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Back     alignment and structure
>3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} Back     alignment and structure
>2h3h_A Sugar ABC transporter, periplasmic sugar-binding protein; glucose binding protein, periplasmic binding protein, GBP; HET: BGC; 1.70A {Thermotoga maritima} PDB: 2qvc_A* 3c6q_B* Back     alignment and structure
>3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, struct genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli} Back     alignment and structure
>3brs_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; 2.00A {Clostridium phytofermentans} Back     alignment and structure
>1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} SCOP: c.93.1.1 PDB: 1jhz_A Back     alignment and structure
>3gbv_A Putative LACI-family transcriptional regulator; NYSGXRC, PSI-II, 11231J, structur genomics, protein structure initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>2qu7_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 2.30A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3d02_A Putative LACI-type transcriptional regulator; periplasmic sugar-binding protein, structura genomics; HET: MSE GOL; 1.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2rjo_A Twin-arginine translocation pathway signal protei; PSI-2, NYSGXRC, twin arginine translocation pathway signal P structural genomics; HET: GAL; 2.05A {Burkholderia phytofirmans} Back     alignment and structure
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} Back     alignment and structure
>3rot_A ABC sugar transporter, periplasmic sugar binding; nysgrc, PSI-biology, structural genomics; 1.91A {Legionella pneumophila subsp} Back     alignment and structure
>2fvy_A D-galactose-binding periplasmic protein; periplasmic binding protien, hinge, chemotaxis, transport,; HET: BGC; 0.92A {Escherichia coli} SCOP: c.93.1.1 PDB: 1glg_A* 2fw0_A* 2gbp_A* 2qw1_A* 2hph_A* 2ipn_A* 2ipm_A* 2ipl_A* 1gca_A* 1gcg_A 3ga5_A* 3gbp_A* Back     alignment and structure
>3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK research center for structural genomics, nysgxrc; 1.99A {Actinobacillus succinogenes} Back     alignment and structure
>1tjy_A Sugar transport protein; protein-ligand complex, signaling protein; HET: PAV; 1.30A {Salmonella typhimurium} SCOP: c.93.1.1 PDB: 1tm2_A 3t95_A* 3ejw_A* Back     alignment and structure
>3g1w_A Sugar ABC transporter; sugar-binding protein, bacillus halod target 11229F, transport protein, structural genomics; 2.02A {Bacillus halodurans c-125} Back     alignment and structure
>2fn9_A Ribose ABC transporter, periplasmic ribose-bindin; RBP, ribose binding protein, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima} PDB: 2fn8_A* Back     alignment and structure
>3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} Back     alignment and structure
>3lkv_A Uncharacterized conserved domain protein; ATPase binding cassette, PSI, MCSG, structural genomics, Pro structure initiative; HET: PHE; 2.20A {Vibrio cholerae} Back     alignment and structure
>2fep_A Catabolite control protein A; CCPA, transcriptional regulator; HET: SEP; 2.45A {Bacillus subtilis} PDB: 2nzu_G* 1sxh_A 1sxi_A 1sxg_A* 2nzv_G* 2oen_G* Back     alignment and structure
>2x7x_A Sensor protein; transferase, sensor histidine kinase; HET: FRU; 2.64A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2vk2_A YTFQ, ABC transporter periplasmic-binding protein YTFQ; transport protein, galactofuranose; HET: GZL; 1.20A {Escherichia coli} Back     alignment and structure
>2ioy_A Periplasmic sugar-binding protein; ribose binding protein, thermophilic proteins; HET: RIP; 1.90A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>2iks_A DNA-binding transcriptional dual regulator; escherichia coli structural genomics, PSI-2, protein structure initiative; 1.85A {Escherichia coli} Back     alignment and structure
>3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* Back     alignment and structure
>2h0a_A TTHA0807, transcriptional regulator; repressor, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>3lft_A Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} Back     alignment and structure
>3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3o1i_D Periplasmic protein TORT; ligand free, two component sensor, periplasmic binding prote signaling protein; HET: PE4; 2.80A {Vibrio parahaemolyticus} PDB: 3o1h_B* 3o1j_C Back     alignment and structure
>3d8u_A PURR transcriptional regulator; APC91343.1, vibrio parahaem RIMD 2210633, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.88A {Vibrio parahaemolyticus} Back     alignment and structure
>2rgy_A Transcriptional regulator, LACI family; 11011J, NYSGXRC, transctiptional regulator, SUG binding protein, structural genomics, PSI-2; 2.05A {Burkholderia phymatum} Back     alignment and structure
>2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} Back     alignment and structure
>3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} Back     alignment and structure
>3k4h_A Putative transcriptional regulator; structural genomics, protein structure INI NEW YORK structural genomix research consortium; HET: MAL; 2.80A {Bacillus cytotoxicus nvh 391-98} Back     alignment and structure
>1jx6_A LUXP protein; protein-ligand complex, signaling protein; HET: AI2; 1.50A {Vibrio harveyi} SCOP: c.93.1.1 PDB: 1zhh_A* 2hj9_A* Back     alignment and structure
>3clk_A Transcription regulator; 11017J, PSI-II, NYSGXRC, dimer, structural genomics, protein structure initiative; 2.08A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3bbl_A Regulatory protein of LACI family; protein structure initiative II, PSI-II, NYSGXRC, transcript regulator, periplasmic binding protein; 2.35A {Chloroflexus aggregans} Back     alignment and structure
>1qpz_A PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} SCOP: a.35.1.5 c.93.1.1 PDB: 1bdi_A* 1qp0_A* 1qp4_A* 1pnr_A* 1wet_A* 1zay_A* 1vpw_A* 2pue_A* 2puf_A* 2pug_A* 1bdh_A* 1qp7_A* 1qqa_A* 1qqb_A* 2puc_A* 2pua_A* 2pub_A* 2pud_A* 1jfs_A* 1jh9_A* ... Back     alignment and structure
>8abp_A L-arabinose-binding protein; binding proteins; HET: GLA GAL; 1.49A {Escherichia coli} SCOP: c.93.1.1 PDB: 7abp_A* 6abp_A* 1abe_A* 1abf_A* 5abp_A* 1bap_A* 1apb_A* 9abp_A* 2wrz_A Back     alignment and structure
>3gv0_A Transcriptional regulator, LACI family; transcription regulator, PSI-II, structural genomics structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>3hcw_A Maltose operon transcriptional repressor; RNA-binding, PSI-2, NYSGXRC, STRU genomics, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>3ctp_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; HET: XLF; 1.41A {Alkaliphilus metalliredigens} Back     alignment and structure
>2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} SCOP: a.35.1.5 c.93.1.1 PDB: 1rzr_G 2jcg_A 1zvv_A 3oqo_A* 3oqm_A* 3oqn_A* Back     alignment and structure
>3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} Back     alignment and structure
>3gyb_A Transcriptional regulators (LACI-family transcriptional regulatory protein); protein structure initiative II(PSI II), nysgxrc; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* Back     alignment and structure
>3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} Back     alignment and structure
>3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} Back     alignment and structure
>3g85_A Transcriptional regulator (LACI family); transcription regulator, PSI-II, structural genomics structure initiative; 1.84A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3k9c_A Transcriptional regulator, LACI family protein; PSI-II, 11026W, structural genomics, PR structure initiative; 2.14A {Rhodococcus jostii} Back     alignment and structure
>3tb6_A Arabinose metabolism transcriptional repressor; transcription regulation, arabinose binding, DNA binding Pro; HET: ARB; 2.21A {Bacillus subtilis} Back     alignment and structure
>3qk7_A Transcriptional regulators; structural genomics, NEW YORK structural genomix research CO NYSGXRC, PSI-2, protein structur initiative; 2.70A {Yersinia pestis} Back     alignment and structure
>3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} Back     alignment and structure
>2dri_A D-ribose-binding protein; sugar transport; HET: RIP; 1.60A {Escherichia coli} SCOP: c.93.1.1 PDB: 1urp_A* 1ba2_A 1dbp_A* 1drj_A* 1drk_A* 2gx6_A* Back     alignment and structure
>3cs3_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative; 2.40A {Enterococcus faecalis} Back     alignment and structure
>3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} Back     alignment and structure
>1byk_A Protein (trehalose operon repressor); LACI family, phosphate binding, protein structure, trehalose repressor, gene regulation; HET: T6P; 2.50A {Escherichia coli} SCOP: c.93.1.1 Back     alignment and structure
>3e61_A Putative transcriptional repressor of ribose OPER; structural genomics, DNA-binding, transcripti regulation, PSI-2; 2.00A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>1gud_A ALBP, D-allose-binding periplasmic protein; periplasmic binding protein, X-RAY crystallography, hinge bending, conformational change; 1.7A {Escherichia coli} SCOP: c.93.1.1 PDB: 1gub_A 1rpj_A* Back     alignment and structure
>3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} Back     alignment and structure
>3uug_A Multiple sugar-binding periplasmic receptor CHVE; periplasmic binding protein, sugar-binding protein, sugar binding protein; HET: BDP; 1.75A {Agrobacterium tumefaciens} PDB: 3urm_A* Back     alignment and structure
>3hs3_A Ribose operon repressor; PSI-II, NYSGXRC, periplasmic binding protein, structural genomics, protein structure initiative; 1.60A {Lactobacillus acidophilus} Back     alignment and structure
>2fqx_A Membrane lipoprotein TMPC; ABC transport system, ligand-binding protein, guanosine, TP0319, transport protein; HET: GMP; 1.70A {Treponema pallidum} PDB: 2fqw_A* 2fqy_A* Back     alignment and structure
>4fe7_A Xylose operon regulatory protein; HTH_ARAC, helix-turn-helix, PBP, periplasmic binding protein binding transcription regulator, DNA xylose; HET: XYS; 2.90A {Escherichia coli} PDB: 4fe4_A Back     alignment and structure
>1jye_A Lactose operon repressor; gene regulation, protein stability, protein DNA-binding, transcription; 1.70A {Escherichia coli} SCOP: c.93.1.1 PDB: 1lbi_A 1lbg_A* 1lbh_A 1jyf_A 3edc_A 1efa_A* 1jwl_A* 2pe5_A* 1tlf_A* 2p9h_A* 2paf_A* 1cjg_A* 1l1m_A 1osl_A 2kei_A* 2kej_A* 2kek_A* 2bjc_A 1lqc_A 1lcc_A* ... Back     alignment and structure
>3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3miz_A Putative transcriptional regulator protein, LACI family; LACL family, protein structure initiative II (PSI II), NYSGXRC, structural genomics; 1.91A {Rhizobium etli} Back     alignment and structure
>3s99_A Basic membrane lipoprotein; ssgcid, structural genomics, SEA structural genomics center for infectious disease, adenine; HET: ADE; 2.05A {Brucella melitensis biovar abortus} Back     alignment and structure
>2hqb_A Transcriptional activator of COMK gene; berkeley structure genomics center target 1957B, structural genomics, PSI; 2.70A {Bacillus halodurans} Back     alignment and structure
>2ozz_A Hypothetical protein YHFZ; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shigella flexneri 2A} SCOP: c.94.1.1 Back     alignment and structure
>3qi7_A Putative transcriptional regulator; periplasmic binding protein-like, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.86A {Clostridium difficile} Back     alignment and structure
>3h5t_A Transcriptional regulator, LACI family; DNA-dependent, protein structure initiative II(PSI II), NYSGXRC, 11232D), structural genomics; 2.53A {Corynebacterium glutamicum} Back     alignment and structure
>3ixl_A Amdase, arylmalonate decarboxylase; enantioselective decarboxylation, lyase; HET: CME PAC; 1.45A {Bordetella bronchiseptica} PDB: 3ixm_A 2vlb_A 3dg9_A 3ip8_A* 3dtv_A* 3eis_A* Back     alignment and structure
>2xed_A Putative maleate isomerase; nicotinic acid catabolism, cofactor-independent CIS-trans isomerase; 1.95A {Nocardia farcinica} PDB: 2xec_A Back     alignment and structure
>3n5l_A Binding protein component of ABC phosphonate TRAN; structural genomics, joint center for structural genomics; HET: UNL; 1.97A {Pseudomonas aeruginosa} Back     alignment and structure
>3p7i_A PHND, subunit of alkylphosphonate ABC transporter; phosphonate binding protein, transport protein; 1.71A {Escherichia coli UTI89} PDB: 3qk6_A 3quj_A* 3s4u_A Back     alignment and structure
>2dgd_A 223AA long hypothetical arylmalonate decarboxylas; octamer, alpha/beta structure, lyase; 2.90A {Sulfolobus tokodaii} Back     alignment and structure
>1jfl_A Aspartate racemase; alpha-beta structure, HOMO-dimer, homologous domains, isomer; 1.90A {Pyrococcus horikoshii} SCOP: c.78.2.1 c.78.2.1 PDB: 2dx7_A* 1iu9_A Back     alignment and structure
>2eq5_A 228AA long hypothetical hydantoin racemase; structural genomics, NPPSFA, national project on P structural and functional analyses; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2fqx_A Membrane lipoprotein TMPC; ABC transport system, ligand-binding protein, guanosine, TP0319, transport protein; HET: GMP; 1.70A {Treponema pallidum} PDB: 2fqw_A* 2fqy_A* Back     alignment and structure
>3bfj_A 1,3-propanediol oxidoreductase; opportunistic pathogens, decamer, structural genomics,struct proteomics in europe, spine; 2.70A {Klebsiella pneumoniae} Back     alignment and structure
>3s99_A Basic membrane lipoprotein; ssgcid, structural genomics, SEA structural genomics center for infectious disease, adenine; HET: ADE; 2.05A {Brucella melitensis biovar abortus} Back     alignment and structure
>3ix1_A N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine protein; periplasmic N-formyl-4-amino-5-aminomethyl-2-methylpyrimidin protein; HET: NFM; 2.40A {Bacillus halodurans c-125} Back     alignment and structure
>3ox4_A Alcohol dehydrogenase 2; iron, NAD, oxidoreductase; HET: NAD; 2.00A {Zymomonas mobilis} PDB: 3owo_A* Back     alignment and structure
>2hqb_A Transcriptional activator of COMK gene; berkeley structure genomics center target 1957B, structural genomics, PSI; 2.70A {Bacillus halodurans} Back     alignment and structure
>2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>1rrm_A Lactaldehyde reductase; structural genomics, dehydrogenase, PSI, protein structure initiative; HET: APR; 1.60A {Escherichia coli} SCOP: e.22.1.2 PDB: 2bi4_A* 2bl4_A* Back     alignment and structure
>2zsk_A PH1733, 226AA long hypothetical aspartate racemase; alpha/beta fold, unknown function; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1vlj_A NADH-dependent butanol dehydrogenase; TM0820, structural G JCSG, protein structure initiative, PSI, joint center for S genomics; HET: NAP; 1.78A {Thermotoga maritima} SCOP: e.22.1.2 Back     alignment and structure
>1o2d_A Alcohol dehydrogenase, iron-containing; TM0920, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE NAP TRS; 1.30A {Thermotoga maritima} SCOP: e.22.1.2 PDB: 1vhd_A* Back     alignment and structure
>3qsl_A Putative exported protein; unknown, structural genomics, PSI-biology, midwest center FO structural genomics, MCSG, unknown function; HET: MSE CIT; 2.00A {Bordetella bronchiseptica} Back     alignment and structure
>2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} Back     alignment and structure
>4ddd_A Immunogenic protein; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, immune system; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>2x26_A Periplasmic aliphatic sulphonates-binding protein; transport protein; 1.75A {Escherichia coli} Back     alignment and structure
>2gzm_A Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A {Bacillus anthracis} Back     alignment and structure
>2oho_A Glutamate racemase; isomerase; 2.25A {Streptococcus pyogenes m1 gas} PDB: 2ohg_A 2ohv_A* Back     alignment and structure
>3uif_A Sulfonate ABC transporter, periplasmic sulfonate- protein SSUA; structural genomics; 2.60A {Methylobacillus flagellatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 633
d1jdpa_401 c.93.1.1 (A:) Hormone binding domain of the atrial 6e-47
d1dp4a_425 c.93.1.1 (A:) Hormone binding domain of the atrial 3e-39
d1ewka_477 c.93.1.1 (A:) Metabotropic glutamate receptor subt 4e-39
d1usga_346 c.93.1.1 (A:) Leucine-binding protein {Escherichia 7e-19
d1qo0a_373 c.93.1.1 (A:) Amide receptor/negative regulator of 9e-17
d2a5sa1277 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate 5e-13
d3ckma1317 c.93.1.1 (A:257-573) YraM C-terminal domain {Haemo 2e-09
d1mqia_260 c.94.1.1 (A:) Glutamate receptor ligand binding co 8e-08
d1pb7a_289 c.94.1.1 (A:) N-methyl-D-aspartate receptor subuni 9e-07
d2f34a1246 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor li 6e-05
d1wdna_223 c.94.1.1 (A:) Glutamine-binding protein {Escherich 1e-04
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 401 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like I
superfamily: Periplasmic binding protein-like I
family: L-arabinose binding protein-like
domain: Hormone binding domain of the atrial natriuretic peptide receptor
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  168 bits (425), Expect = 6e-47
 Identities = 62/421 (14%), Positives = 126/421 (29%), Gaps = 45/421 (10%)

Query: 30  PPVLNIGAVFALNST---IGKVAKVAIEAAVEDVNSNPA----ILGGTKLKLTVHDTNYS 82
           P  + +  +   + +        + AIE A+  V  N      +  GT+ ++   D++  
Sbjct: 5   PQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCG 64

Query: 83  --RFLGMVEALTLLENETV-AIIGPQFSVIAHLVSHIANEFQVPLLSFAATDPSLSS--L 137
                 +V+ +          I+GP     A  V+ +A+ + +P+LS  A          
Sbjct: 65  NRALFSLVDRVAAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDS 124

Query: 138 QYPFFVRTTQSDLYQMAAIADIVDYFGWRNVIALYVDDDHGRNGIAALGDKLAEKRCRLS 197
           +Y    R   +       +  +  +  W     +Y DD   RN    L       +    
Sbjct: 125 EYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGL 184

Query: 198 HKVPLSPKGSRNQIIDTLLTVSSMMSRILILHTYDIWGLEVLNAAKHLRMMESGYVWIVT 257
           H    S   +++  ++ ++       R++I+         ++  A    M    Y +   
Sbjct: 185 HTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNI 244

Query: 258 DWLSSILDTDSQLHSEKMDD------IQGVLTLRMYTQSSEEKRKFVTRWRHLTRRNTLN 311
           +  +S    D         D         + T+ +      E  KF    +    +  LN
Sbjct: 245 ELFNSSSYGDGSWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLN 304

Query: 312 GPIGLNSFGLYAYDTLWLLAHAIGAFFDQGGNISFSEDSKLSELSRGDMRFSSVSIFNGG 371
               +N F    +D + L   A+      G +                           G
Sbjct: 305 MEDYVNMFVEGFHDAILLYVLALHEVLRAGYSK------------------------KDG 340

Query: 372 KMLLDNILQVNMTGVTGPIKFTS--DRDLINPAYEVINVIGTGSRRIGYWSNHSG-LSVV 428
             ++         G+ G +   +  DR        + +V       IG +    G   + 
Sbjct: 341 GKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIAMTDVEAGTQEVIGDYFGKEGRFEMR 400

Query: 429 P 429
           P
Sbjct: 401 P 401
>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 425 Back     information, alignment and structure
>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 477 Back     information, alignment and structure
>d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} Length = 373 Back     information, alignment and structure
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Length = 277 Back     information, alignment and structure
>d3ckma1 c.93.1.1 (A:257-573) YraM C-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 317 Back     information, alignment and structure
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Length = 260 Back     information, alignment and structure
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 289 Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Length = 246 Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Length = 223 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query633
d1ewka_477 Metabotropic glutamate receptor subtype 1 {Rat (Ra 100.0
d1dp4a_425 Hormone binding domain of the atrial natriuretic p 100.0
d1jdpa_401 Hormone binding domain of the atrial natriuretic p 100.0
d1usga_346 Leucine-binding protein {Escherichia coli [TaxId: 100.0
d1qo0a_373 Amide receptor/negative regulator of the amidase o 100.0
d3ckma1317 YraM C-terminal domain {Haemophilus influenzae [Ta 99.94
d2a5sa1277 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 99.61
d1pb7a_289 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 99.46
d1mqia_260 Glutamate receptor ligand binding core {Rat (Rattu 99.44
d1wdna_223 Glutamine-binding protein {Escherichia coli [TaxId 99.37
d2f34a1246 Glutamate receptor ligand binding core {Rat (Rattu 99.36
d1ii5a_226 Glutamate receptor ligand binding core {Synechocys 99.28
d1lsta_238 Lysine-,arginine-,ornithine-binding (LAO) protein 99.27
d1xt8a1248 Putative amino-acid transporter CjaA {Campylobacte 99.23
d1jyea_271 Lac-repressor (lacR) core (C-terminal domain) {Esc 98.27
d2fvya1305 Galactose/glucose-binding protein {Escherichia col 98.2
d1jx6a_338 Quorum-sensing signal (autoinducer-2) binding prot 98.1
d8abpa_305 L-arabinose-binding protein {Escherichia coli [Tax 98.06
d1dbqa_282 Purine repressor (PurR), C-terminal domain {Escher 97.97
d2nzug1275 Glucose-resistance amylase regulator CcpA, C-termi 97.85
d1byka_255 Trehalose repressor, C-terminal domain {Escherichi 97.79
d2dria_271 D-ribose-binding protein {Escherichia coli, strain 97.65
d1guda_288 D-allose-binding protein {Escherichia coli [TaxId: 97.62
d1tjya_316 AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370 96.9
d1vlja_398 NADH-dependent butanol dehydrogenase A (TM0820) {T 91.72
d1rrma_385 Lactaldehyde reductase FucO {Escherichia coli [Tax 90.37
d1vmea1148 ROO-like flavoprotein TM0755, C-terminal domain {T 88.62
d1o2da_359 Alcohol dehydrogenase TM0920 {Thermotoga maritima 87.75
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 81.69
>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like I
superfamily: Periplasmic binding protein-like I
family: L-arabinose binding protein-like
domain: Metabotropic glutamate receptor subtype 1
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=6.7e-48  Score=409.14  Aligned_cols=373  Identities=18%  Similarity=0.312  Sum_probs=310.3

Q ss_pred             CCeEEEEEEeecCC-----------------ccchhHHHHHHHHHHHHhcCCCCCCCcEEEEEEecCCCChHHHHHHHHH
Q 006727           30 PPVLNIGAVFALNS-----------------TIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFLGMVEALT   92 (633)
Q Consensus        30 ~~~i~IG~l~p~~~-----------------~~g~~~~~a~~~Ave~iN~~~~il~g~~l~~~~~D~~~~~~~a~~~~~~   92 (633)
                      +++|.||++||.|.                 ..|.....|+.+|||+||++..+|||++|++.++|+|+++..+++.+.+
T Consensus         7 ~Gd~~iGGlFp~h~~~~~~~~~~~~c~~~~~~~g~~~~~Am~~Aie~IN~~~~lLPn~tLg~~i~Dtc~~~~~a~~~~~~   86 (477)
T d1ewka_           7 DGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIE   86 (477)
T ss_dssp             CCSEEEEEEECSBCCCCTTTGGGTCCCCBCTTTTHHHHHHHHHHHHHHHHCSSSSTTCCEEEEEEECTTCHHHHHHHHHH
T ss_pred             CCCEEEEEEEECcCcCCCCCCCccccccccccccHHHHHHHHHHHHHHhCCCCcCCCCEEEEEEEEcCCChHHHHHHHHH
Confidence            68999999999961                 1255678899999999999999999999999999999999999999998


Q ss_pred             HHh-----------------------------cCceEEEcCCchhhHHHHHHhhccCCccEEeeccCCCCCcc-CCCCce
Q 006727           93 LLE-----------------------------NETVAIIGPQFSVIAHLVSHIANEFQVPLLSFAATDPSLSS-LQYPFF  142 (633)
Q Consensus        93 li~-----------------------------~~v~aviG~~~s~~~~~va~~~~~~~iP~Is~~a~~~~ls~-~~~~~~  142 (633)
                      ++.                             .+|.+||||.+|..+.+++.++..++||+||++++++.|++ ..||+|
T Consensus        87 ~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~aviGp~~s~~s~~va~~~~~~~iP~IS~~ats~~lsd~~~yp~f  166 (477)
T d1ewka_          87 FIRDSLISIRDEKDGLNRCLPDGQTLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYF  166 (477)
T ss_dssp             HHC-----------------------------CCEEEEECCSSHHHHHHHHHHHGGGTCCEEESSCCCGGGGCTTTCTTE
T ss_pred             HHHhhhcccccccccccccccCCccccccccccceEEEECCCcchhHHHHHHHhhhccCceeccccCCccccccccCCce
Confidence            873                             25899999999999999999999999999999999999988 689999


Q ss_pred             EEecCChHHHHHHHHHHHHHcCCcEEEEEEecCCCcchhHHHHHHHHhhcCcEEEEEeecCCCCChhhHHHHHHHhhcC-
Q 006727          143 VRTTQSDLYQMAAIADIVDYFGWRNVIALYVDDDHGRNGIAALGDKLAEKRCRLSHKVPLSPKGSRNQIIDTLLTVSSM-  221 (633)
Q Consensus       143 ~r~~p~~~~~~~al~~ll~~~~w~~v~ii~~d~~~g~~~~~~~~~~~~~~g~~v~~~~~~~~~~~~~~~~~~l~~i~~~-  221 (633)
                      ||+.|++..+++++++++++|+|++|++|+++++||....+.|++.+++.|+||.....++...+..++...++++++. 
T Consensus       167 ~Rt~psd~~~~~ai~~ll~~f~W~~V~vi~~~d~~g~~~~~~l~~~~~~~~i~v~~~~~i~~~~~~~~~~~~l~~l~~~~  246 (477)
T d1ewka_         167 LRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERL  246 (477)
T ss_dssp             EESSCCHHHHHHHHHHHHHHTTCCEEEEEEESSHHHHHHHHHHHHHHHHHTCEEEEEEEECTTCCHHHHHHHHHHHHTTT
T ss_pred             EEecccchhhHHHHHHHHHHcCCcEEEEEEecchhHHHHHHHHHHHHHHcCcEEEEEeeccCCCchhhHHHHHHHHhhhc
Confidence            9999999999999999999999999999999999999999999999999999999988887667788999999999875 


Q ss_pred             -CCeEEEEeeChHHHHHHHHHHHHcCCCCCCeEEEEeCccccccCCCccccccccccccceEEEeeecCCChHHHHHH--
Q 006727          222 -MSRILILHTYDIWGLEVLNAAKHLRMMESGYVWIVTDWLSSILDTDSQLHSEKMDDIQGVLTLRMYTQSSEEKRKFV--  298 (633)
Q Consensus       222 -~~~vIvl~~~~~~~~~il~~a~~~g~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~f~--  298 (633)
                       ++++||+++....+..++++|+++||++ .+.|++++++.......    ........|.+++.+..+..+.+++|.  
T Consensus       247 ~~~rVIv~~~~~~~~~~ll~~a~~~g~~g-~~~~i~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~i~~f~~~~~~  321 (477)
T d1ewka_         247 PKARVVVCFCEGMTVRGLLSAMRRLGVVG-EFSLIGSDGWADRDEVI----EGYEVEANGGITIKLQSPEVRSFDDYFLK  321 (477)
T ss_dssp             TTCCEEEEECCHHHHHHHHHHHHHHTCCS-CCEEEECTTTTTCHHHH----TTCHHHHTTCEEEEECCCCCHHHHHHHTT
T ss_pred             cCceEEEEecCHHHHHHHHHHHHHcCccC-CceEEEecccccchhhc----cccccccCcceEeeeccccchhHHHHHHh
Confidence             7899999999999999999999999985 47788888765432221    122244567778887777776665543  


Q ss_pred             -------------HHHHHhhccCC---------------C----CCCCCCCchhHHHhhHHHHHHHHHHHhhhcCCCccc
Q 006727          299 -------------TRWRHLTRRNT---------------L----NGPIGLNSFGLYAYDTLWLLAHAIGAFFDQGGNISF  346 (633)
Q Consensus       299 -------------~~~~~~~~~~~---------------~----~~~~~~~~~~~~~yDav~~~~~Al~~~~~~~~~~~~  346 (633)
                                   +.|+..+++..               .    ........++.++||||+++|+||++++++.+.   
T Consensus       322 ~~~~~~~~n~~~~~~w~~~f~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yDAV~a~A~AL~~~~~~~~~---  398 (477)
T d1ewka_         322 LRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCP---  398 (477)
T ss_dssp             CCTTTCCSCTTHHHHHHHHTTCBCTTCTTCCTTCCSBCCSCCCTTTTCCCCTTHHHHHHHHHHHHHHHHHHHHHHST---
T ss_pred             cCcccCCCChHHHHHHHHHhCCCcccccccCccccccccchhhcccccccchHHHHHHHHHHHHHHHHHHHHHhhCC---
Confidence                         44555554210               0    011123467889999999999999999875432   


Q ss_pred             ccCcccccccCCCcccccccccCchHHHHHHHHhcccccccc-ceEEccCCCCCCCcEEEEEeec---C--CeeEEeeec
Q 006727          347 SEDSKLSELSRGDMRFSSVSIFNGGKMLLDNILQVNMTGVTG-PIKFTSDRDLINPAYEVINVIG---T--GSRRIGYWS  420 (633)
Q Consensus       347 ~~~~~~~~~~~~~~~c~~~~~~~~~~~l~~~l~~~~f~g~~G-~v~Fd~~g~r~~~~~~I~~~~~---~--~~~~vg~w~  420 (633)
                                ....+|.....+ ++..|.++|++++|.|++| .|.||++||+. ..|+|+|++.   +  .+++||+|+
T Consensus       399 ----------~~~~~~~~~~~~-~~~~l~~~l~~v~F~G~tG~~v~Fd~nGd~~-~~y~I~n~q~~~~~~~~~~~VG~w~  466 (477)
T d1ewka_         399 ----------GHVGLCDAMKPI-DGRKLLDFLIKSSFVGVSGEEVWFDEKGDAP-GRYDIMNLQYTEANRYDYVHVGTWH  466 (477)
T ss_dssp             ----------TCSSCCGGGSSC-CHHHHHHHHHTCEEECTTSCEEECCTTSCCC-CCEEEEEEEECSSSCEEEEEEEEEE
T ss_pred             ----------CCCCcccCCCcC-CHHHHHHHHhcCeeECCCCCEEEECCCCCcc-ceEEEEEEEECCCCcEEEEEEEEEe
Confidence                      223356655555 4999999999999999999 59999999975 8899999873   2  468999998


Q ss_pred             CC
Q 006727          421 NH  422 (633)
Q Consensus       421 ~~  422 (633)
                      +.
T Consensus       467 ~~  468 (477)
T d1ewka_         467 EG  468 (477)
T ss_dssp             TT
T ss_pred             CC
Confidence            63
>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3ckma1 c.93.1.1 (A:257-573) YraM C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Back     information, alignment and structure
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Back     information, alignment and structure
>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} Back     information, alignment and structure
>d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1jyea_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fvya1 c.93.1.1 (A:2-306) Galactose/glucose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jx6a_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d8abpa_ c.93.1.1 (A:) L-arabinose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nzug1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dria_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]} Back     information, alignment and structure
>d1guda_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rrma_ e.22.1.2 (A:) Lactaldehyde reductase FucO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o2da_ e.22.1.2 (A:) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure