Citrus Sinensis ID: 006731


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630---
MGSNNKPETEETRKRIEENHEEEEEEEETEQDWGDWSEDDGGLESGFLCLFCDAGYSSCDTLFEHCRLSHCFDFHSVKTELRLDFYGSFKLINYIRSQVAENRCWICGLTCQSNQDLQNHLHEAYNLKETKLRWDKEKYLKPFMQDDKLLYSFGEDEVDEEDNDAELMRDVMNFENISVDDGSSKDKSATNNCTADEIGKVAAVSTLNGHPNMENSSEKMIVNGFDSREHIGAFDSKLEDKDSRVSLLKLSAKDIKKVNESYFGSYSSFGIHREMISDKVRTDSYRQAILENPSLMKGAVVMDIGCGTGILSLFAAQAGASRVIAVEASEKMAAVATQIAKDNDFWWDRPQSEGNINNAGKMEVVQGMVEELGESMQIQPHSVDVLVSEWMGYCLLYESMLSSVLFARDQWLKPGGAILPDTATMFVAGFGRGGTSLPFWENVYGFTMSCVGREVVQDAAGIPIVDVVDDHDLVTDSVVLQTFDLATMKHDEVDFTTSVELEPKLGDSTSNSTELRSTSTWCYGIVLWFDAGFTSRFCKEKPVVLSTSPYTPKTHWSQTIITFREPIALALGNLGADGSAAVGTDACPARRIHLRVSIARGAVHRSIDISMETAGVGPDGQKRSWPAQIFNLS
ccccccccccHHHHHHccccccccccccccccccccccccccccccEEEcccccccccHHHHHHHHHHHccccHHHcccccccccccEEEEEEEEcccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHccccccccccccccccccccHHHHHcccHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHcccccccccccccccccccEEEEEcEEEEccccccccccccEEEEEcccccccccccccHHHHHHHHHcccccccccccccEEEEEEEccccccccccccccccccccHHHHHHHHHcccccEEECcccccccccEEEEEEEcccccccccCEEEEEEEEEEcccccccccccccccccEEEEEEEEEEEccccccccccEEEEccccccccccEEEEEEccccEEcccccEEEEEEEEEECcccccCEEEEEEEEEEccEEEEEEEEEEEEEEcccccCEEEEEEEEccc
***********************************WSEDDGGLESGFLCLFCDAGYSSCDTLFEHCRLSHCFDFHSVKTELRLDFYGSFKLINYIRSQVAENRCWICGLTCQSNQDLQNHLHEAYNLKETKLRWDKEKYLKPFMQDDKLLYSFGEDEVDEEDNDAELMRDVMNFENISVD**********NNC*ADEIGKVAAVSTLNGHPNMEN******************************************VNESYFGSYSSFGIHREMISDKVRTDSYRQAILENPSLMKGAVVMDIGCGTGILSLFAAQAGASRVIAVEASEKMAAVATQIAKDNDFWWDRPQSEGNINNAGKMEVVQGMVEELGESMQIQPHSVDVLVSEWMGYCLLYESMLSSVLFARDQWLKPGGAILPDTATMFVAGFGRGGTSLPFWENVYGFTMSCVGREVVQDAAGIPIVDVVDDHDLVTDSVVLQTFDLATMKHDEVDFTTSVELEPKLGDSTSNST*LRSTSTWCYGIVLWFDAGFTSRFCKEKPVVLSTSPYTPKTHWSQTIITFREPIALALGNLGADGSAAVGTDACPARRIHLRVSIARGAVHRSIDIS****************AQIFNL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSNNxxxxxxxxxxxxxxxxxxxxxEETEQDWGDWSEDDGGLESGFLCLFCDAGYSSCDTLFEHCRLSHCFDFHSVKTELRLDFYGSFKLINYIRSQVAENRCWICGLTCQSNQDLQNHLHEAYNLKETKLRWDKEKYLKPFMQDDKLLYSFGEDEVDEEDNDAELMRDVMNFENISVDDGSSKDKSATNNCTADEIGKVAAVSTLNGHPNMENSSEKMIVNGFDSREHIGAFDSKLEDKDSRVSLLKLSAKDIKKVNESYFGSYSSFGIHREMISDKVRTDSYRQAILENPSLMKGAVVMDIGCGTGILSLFAAQAGASRVIAVEASEKMAAVATQIAKDNDFWWDRPQSEGNINNAGKMEVVQGMVEELGESMQIQPHSVDVLVSEWMGYCLLYESMLSSVLFARDQWLKPGGAILPDTATMFVAGFGRGGTSLPFWENVYGFTMSCVGREVVQDAAGIPIVDVVDDHDLVTDSVVLQTFDLATMKHDEVDFTTSVELEPKLGDSTSNSTELRSTSTWCYGIVLWFDAGFTSRFCKEKPVVLSTSPYTPKTHWSQTIITFREPIALALGNLGADGSAAVGTDACPARRIHLRVSIARGAVHRSIDISMETAGVGPDGQKRSWPAQIFNLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable protein arginine N-methyltransferase 3 Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins.probableQ0WVD6
Probable protein arginine N-methyltransferase 3 Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins.probableA3BMN9
Probable protein arginine N-methyltransferase 3 Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins.probableA2YP56

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1G6Q, chain 1
Confidence level:very confident
Coverage over the Query: 261-346,360-506,520-577,595-632
View the alignment between query and template
View the model in PyMOL
Template: 1WIR, chain A
Confidence level:very confident
Coverage over the Query: 43-99,111-160
View the alignment between query and template
View the model in PyMOL
Template: 4IKP, chain A
Confidence level:confident
Coverage over the Query: 262-343,357-464,480-573
View the alignment between query and template
View the model in PyMOL
Template: 2YT9, chain A
Confidence level:probable
Coverage over the Query: 44-126
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 7-38
View the alignment between query and template
View the model in PyMOL