Citrus Sinensis ID: 006755


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630--
MKLQVKVTFACLIGLIWIQRSICDKLSERSGQKNWKCTCSSSLQGDQSNILKLNCSRSCDCSPAVGGSSEGKWTCICAADGLPKVAANSYDTTCFASCTCTSGSVSGVKASGKHISSKVVVIVLLLCVILTTIAFLMLVLCYVYRKGKFHLRSSVISSDKESCNSATNLISHRITSVPETRVEVVSPIDLATGCFLKTTFCRSKTWTIHGTIIRFSYSALEHATDKFSGSNIVGQGGSSYVYRGQLTDGRIVAVKRFKTQGGPNADSVFLTEVDMLSRLHHCHVVPLVGYCSEFRGKRAMRLLVFEFMPNGNLRDCLDGVLVEGMNWDTRVAIAIGAARGLEYLHEAAAPRILHRDIKSSNILLDENLNAKITDLGMAKRLKADGLPSCSSSPARMQGTFGYFAPEYAMVGRASLMSDVFSFGVVLLELITGRQPIHRSITKGEESLVLWATPRLQDSGTVISELPDPRLKGDFPKEEMQIMAYLAKECLQLDPDARPTMSEVVQILSTIAPDKSRRRNISLNLFQIFSAGGMEKEPSIERPDNLFETLIESEELKKATSFGSPRCSQAVDTDITLNTRSNSKEEDTVSTEYMEKLLLLTSEVRSSRAPDIETVDLTEPRFESFCMKNVNSP
cccHHHHHHHHHHHHHHHHHHHcccccccccccccCEEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHHHHHEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccCEEEEECccccEEEEEEccccccccccHHHHHHHHHHHcccccccccccCEEEcccccccEEEEEEEEcccccHHHHccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccc
***QVKVTFACLIGLIWIQRSICDKLSERSGQKNWKCTCSSSLQGDQSNILKLNCSRSC**********EGKWTCICAADGLPKVAANSYDTTCFASCTCTSG*********KHISSKVVVIVLLLCVILTTIAFLMLVLCYVYRKGKFHLRSS**********SATNLISHRITSVPETRVEVVSPIDLATGCFLKTT*****TWTIHGTIIRFSYSALEHATDKFSGSNIVGQGGSSYVYRGQLTDGRIVAVKRFKTQGGPNADSVFLTEVDMLSRLHHCHVVPLVGYCSEFRGKRAMRLLVFEFMPNGNLRDCLDGVLVEGMNWDTRVAIAIGAARGLEYLHEAAAPRILHRDIKSSNILLDENLNAKITDLGMAKRLKA****SCSSSPARMQGTFGYFAPEYAMVGRASLMSDVFSFGVVLLELITGRQPIHRSITKGEESLVLWATPRLQDSGTVISELPDPRLKGDFPKEEMQIMAYLAKECLQLDPDARPTMSEVVQILSTIA******RNI***************************************************************************LLLL*******************PRFESFCMKNV***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLQVKVTFACLIGLIWIQRSICDKLSERSGQKNWKCTCSSSLQGDQSNILKLNCSRSCDCSPAVGGSSEGKWTCICAADGLPKVAANSYDTTCFASCTCTSGSVSGVKASGKHISSKVVVIVLLLCVILTTIAFLMLVLCYVYRKGKFHLRSSVISSDKESCNSATNLISHRITSVPETRVEVVSPIDLATGCFLKTTFCRSKTWTIHGTIIRFSYSALEHATDKFSGSNIVGQGGSSYVYRGQLTDGRIVAVKRFKTQGGPNADSVFLTEVDMLSRLHHCHVVPLVGYCSEFRGKRAMRLLVFEFMPNGNLRDCLDGVLVEGMNWDTRVAIAIGAARGLEYLHEAAAPRILHRDIKSSNILLDENLNAKITDLGMAKRLKADGLPSCSSSPARMQGTFGYFAPEYAMVGRASLMSDVFSFGVVLLELITGRQPIHRSITKGEESLVLWATPRLQDSGTVISELPDPRLKGDFPKEEMQIMAYLAKECLQLDPDARPTMSEVVQILSTIAPDKSRRRNISLNLFQIFSAGGMEKEPSIERPDNLFETLIESEELKKATSFGSPRCSQAVDTDITLNTRSNSKEEDTVSTEYMEKLLLLTSEVRSSRAPDIETVDLTEPRFESFCMKNVNSP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Receptor-like serine/threonine-protein kinase NCRK probableQ8VYY5

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VHE, chain A
Confidence level:very confident
Coverage over the Query: 323-447,461-511
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 211-510
View the alignment between query and template
View the model in PyMOL
Template: 4APC, chain A
Confidence level:confident
Coverage over the Query: 225-449,461-529
View the alignment between query and template
View the model in PyMOL
Template: 2L2T, chain A
Confidence level:probable
Coverage over the Query: 122-149
View the alignment between query and template
View the model in PyMOL
Template: 3H5C, chain B
Confidence level:probable
Coverage over the Query: 19-103
View the alignment between query and template
View the model in PyMOL