BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 006766
         (632 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2K27|A Chain A, Solution Structure Of Human Pax8 Paired Box Domain
          Length = 159

 Score = 30.0 bits (66), Expect = 4.3,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 419 IRQGLIEPPKPKVKMSNLMKVLGSEATQDPTRLEKEIR 456
           IR G+I   KPKV    +++ +G    Q+PT    EIR
Sbjct: 71  IRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIR 108


>pdb|3FIK|T Chain T, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
           Consists Of The 50s Subunit.
 pdb|2WWQ|T Chain T, E.Coli 70s Ribosome Stalled During Translation Of Tnac
           Leader Peptide. This File Contains The 50s, The P-Site
           Trna And The Tnac Leader Peptide (Part 2 Of 2).
 pdb|3OFQ|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3OFR|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome With Erthromycin Bound.
 pdb|3OFC|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 50s Subunit Of
           The First 70s Ribosome With Chloramphenicol Bound.
 pdb|3OFD|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 50s Subunit Of
           The Second 70s Ribosome.
 pdb|3OFZ|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome Bound To Clindamycin.
 pdb|3OG0|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3OAS|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3OAT|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome With Telithromycin Bound.
 pdb|3R8S|T Chain T, Structures Of The Bacterial Ribosome In Classical And
           Hybrid States Of Trna Binding
 pdb|3R8T|T Chain T, Structures Of The Bacterial Ribosome In Classical And
           Hybrid States Of Trna Binding
 pdb|3J19|T Chain T, Structure Of The Bacterial Ribosome Complexed By
           Tmrna-Smpb And Ef-G During Translocation And Mld-Loading
           (50s Subunit)
          Length = 93

 Score = 28.9 bits (63), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 3/32 (9%)

Query: 532 CEGINVVVVEGGSKSIKRYGKLMLRRIDWAKA 563
            E +N +VV+G    +KR+G+ + RR DW KA
Sbjct: 55  VEVVNTLVVKG---KVKRHGQRIGRRSDWKKA 83


>pdb|1P85|R Chain R, Real Space Refined Coordinates Of The 50s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
           State Of E. Coli 70s Ribosome
 pdb|1P86|R Chain R, Real Space Refined Coordinates Of The 50s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The
           Initiation-Like State Of E. Coli 70s Ribosome
 pdb|2AW4|T Chain T, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2AWB|T Chain T, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 50s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes And Is
           Described In Remark 400.
 pdb|1VS6|T Chain T, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|1VS8|T Chain T, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2I2T|T Chain T, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2I2V|T Chain T, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2QOV|T Chain T, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 50s Subunit Of The First 70s Ribosome.
           The Entire Crystal Structure Contains Two 70s Ribosomes.
 pdb|2QOX|T Chain T, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 50s Subunit Of The Second 70s
           Ribosome. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 pdb|2QOZ|T Chain T, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome, With Neomycin Bound. The Entire
           Crystal Structure Contains Two 70s Ribosomes.
 pdb|2QP1|T Chain T, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome, With Neomycin Bound. The Entire
           Crystal Structure Contains Two 70s Ribosomes.
 pdb|2QAM|T Chain T, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 50s Subunit Of The First 70s Ribosome, With
           Neomycin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2QAO|T Chain T, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 50s Subunit Of The Second 70s Ribosome,
           With Neomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QBA|T Chain T, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 50s Subunit Of The First 70s Ribosome, With
           Gentamicin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2QBC|T Chain T, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 50s Subunit Of The Second 70s Ribosome,
           With Gentamicin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QBE|T Chain T, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 50s Subunit Of The
           First 70s Ribosome, With Rrf Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2QBG|T Chain T, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 50s Subunit Of The
           Second 70s Ribosome, With Rrf Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2QBI|T Chain T, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 50s
           Subunit Of The First 70s Ribosome, With Gentamicin And
           Rrf Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2QBK|T Chain T, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 50s
           Subunit Of The Second 70s Ribosome, With Gentamicin And
           Rrf Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2Z4L|T Chain T, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           50s Subunit Of The First 70s Ribosome, With Paromomycin
           And Rrf Bound. The Entire Crystal Structure Contains Two
           70s Ribosomes And Is Described In Remark 400.
 pdb|2Z4N|T Chain T, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           50s Subunit Of The Second 70s Ribosome, With Paromomycin
           And Rrf Bound. The Entire Crystal Structure Contains Two
           70s Ribosomes And Is Described In Remark 400.
 pdb|2VHM|T Chain T, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 1 Of 4)
 pdb|2VHN|T Chain T, Structure Of Pdf Binding Helix In Complex With The
           Ribosome. (Part 2 Of 4)
 pdb|2RDO|T Chain T, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound
 pdb|2VRH|B Chain B, Structure Of The E. Coli Trigger Factor Bound To A
           Translating Ribosome
 pdb|3DF2|T Chain T, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 50s Subunit Of The First 70s Ribosome. The
           Entire Crystal Structure Contains Two 70s Ribosomes.
 pdb|3DF4|T Chain T, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 50s Subunit Of The Second 70s Ribosome. The
           Entire Crystal Structure Contains Two 70s Ribosomes.
 pdb|3BBX|T Chain T, The Hsp15 Protein Fitted Into The Low Resolution Cryo-Em
           Map 50s.Nc-Trna.Hsp15 Complex
 pdb|3I1N|T Chain T, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1P|T Chain T, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1R|T Chain T, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1T|T Chain T, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I20|T Chain T, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I22|T Chain T, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3KCR|T Chain T, Ribosome-Secy Complex. This Entry 3kcr Contains 50s
           Ribosomal Subnit. The 30s Ribosomal Subunit Can Be Found
           In Pdb Entry 3kc4
 pdb|1VT2|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3ORB|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 50s Subunit Of The First
           70s Ribosome Bound To Cem-101.
 pdb|3IZT|U Chain U, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Large Subunit Of A Ribosome Programmed With A
           Near-Cognate Codon.
 pdb|3IZU|U Chain U, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Large Subunit Of A Ribosome Programmed With A Cognate
           Codon
 pdb|3J01|T Chain T, Structure Of The Ribosome-Secye Complex In The Membrane
           Environment
 pdb|3SGF|X Chain X, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp
           State On A Rotated Conformation Of The Ribosome
 pdb|3UOS|X Chain X, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp
           State On A Rotated Conformation Of The Ribosome (Without
           Viomycin)
 pdb|3J0T|V Chain V, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class2 Of The Six
           Classes)
 pdb|3J0W|V Chain V, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 4a Of The Six
           Classes)
 pdb|3J0Y|V Chain V, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 4b Of The Six
           Classes)
 pdb|3J11|V Chain V, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 3 Of The Six
           Classes)
 pdb|3J12|V Chain V, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 5 Of The Six
           Classes)
 pdb|3J14|V Chain V, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 6 Of The Six
           Classes)
 pdb|4GAR|T Chain T, Allosteric Control Of The Ribosome By Small-Molecule
           Antibiotics
 pdb|4GAU|T Chain T, Allosteric Control Of The Ribosome By Small-Molecule
           Antibiotics
          Length = 100

 Score = 28.9 bits (63), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 3/32 (9%)

Query: 532 CEGINVVVVEGGSKSIKRYGKLMLRRIDWAKA 563
            E +N +VV+G    +KR+G+ + RR DW KA
Sbjct: 55  VEVVNTLVVKG---KVKRHGQRIGRRSDWKKA 83


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.135    0.391 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,060,693
Number of Sequences: 62578
Number of extensions: 507119
Number of successful extensions: 1170
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 1169
Number of HSP's gapped (non-prelim): 9
length of query: 632
length of database: 14,973,337
effective HSP length: 105
effective length of query: 527
effective length of database: 8,402,647
effective search space: 4428194969
effective search space used: 4428194969
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)