Citrus Sinensis ID: 006767


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630--
MDAPLAAWPWDNLGMFKYVLYGPLVGKALYSWVYEDKRIEYWCLHILIISVLRGLIHILWNSFSNMLFLNRARQINQRGVDFKQIDNEWNWDNFILLQAAIASMGYYIFPCSESLPRWNTKGFIALQILHVAVSEPLYYVLHRHFHRNKYLFIHYHSLHHSSPVPQIPTAGHATLLEHIVLSAIVAIPILGSSIIGYGSISLIYGYILMFDFLRCLGHCNVEIIPHRWFETFPFLRYLLYTPTYHSLHHTEKDSNFCLFMPLFDALGNTLNSKSWEDHKKITSASGENVRVPDFVFLAHVVDVTASMHPPFVFRSLASLPYSPKLFMLPFWPLAFSAMFALWAWSKTFLISFYWLRGRLHQTWAVPRYGFQYFLPFAQTGINKQIEDAILRADRLGVKVLSLAALNKNESLNGGGTLFVDKHPNLKVRVVHGNTCTAAVILNELPKDVKEVFLTGATSKLGRAIALYLCRKRVRVLMLTLSTERFQKIQKEAPIDCQNYLVQVTKYQAAQHSKTWIVGKWITPREQNWAPPGTHFHQFVVPPILHFRRDCTYGDLAAMRLPDDVEGLGICEYTMDRGVVHACHAGGVVHLLEGWTHHEVGAIDVDKIDLVWEAALKHGFKPVSSLRNRQISS
ccccccccccccccccEEEEEEHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccEEcccccccccccEEEEEEccccccccccccccccccccHHHHHHccccccccHHHHHHHHccccccccccccEEEccccccccccccccHHHHcccccccccccccccHHHHHHHHHHHHHHccEEEEEEEEccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccEEEEccccccEEEEcccHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHcccccccccEEEEEEccccccccEEEEcccccHHHHcccccccEEEEccccccccccccEEEEcccccccccccccccccccccccccEEHHHHHHHHHHHcccccccccccccccHHHHHHHHHHcccccccccHHHHccc
ccccccccccccccccEEEEEHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccccccHccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccHHccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccEEccHHHHHHccccHEEEEcccHccHHHHHcccccHHHHHHHHHHHccccccHHHHHHHHHcccccccccccEEEEEEcccHHHHHHcHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEHHHHcccccEEEEEcccccEccccHHHHHHHHHHHHHHHHHHHcccEEEEEHHHccHHHHccccEEEEEcccccEEEEEcccHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHccHHHHHHEEEEcccccccccEEEEEEccccHHHHHccccccEEEEccccccHHHHccccccccccEcccccccccccHHHHcccccEHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHcc
mdaplaawpwdnlgmfKYVLYGPLVGKALYSWVYEDKRIEYWCLHILIISVLRGLIHILWNSFSNMLFLNRARQINqrgvdfkqidnewnwDNFILLQAAIASMGyyifpcseslprwntkgfIALQILHVAVSEPLYYVLHRHFHRNKYLFIHYhslhhsspvpqiptagHATLLEHIVLSAIVAIpilgssiigYGSISLIYGYILMFDFLRCLghcnveiiphrwfetfpflryllytptyhslhhtekdsnfclfMPLFDALGNTLNSKSWEDHKKItsasgenvrvpDFVFLAHVVDvtasmhppfvfrslaslpyspklfmlpfwpLAFSAMFALWAWSKTFLISFYWLRGrlhqtwavprygfqyflpfaqtGINKQIEDAILRADRLGVKVLSLAALnkneslngggtlfvdkhpnlkvRVVHGNTCTAAVILNELPKDVKEVFLTGATSKLGRAIALYLCRKRVRVLMLTLSTERFQKIQKEAPIDCQNYLVQVTKYQAAQHSKtwivgkwitpreqnwappgthfhqfvvppilhfrrdctygdlaamrlpddveglgiceytmdrgvvhaCHAGGVVHLlegwthhevgaidvdKIDLVWEAALKhgfkpvsslrnrqiss
mdaplaawpwdnlGMFKYVLYGPLVGKALYSWVYEDKRIEYWCLHILIISVLRGLIHILWNSFSNMLFLNRARQINQRGVDFKQIDNEWNWDNFILLQAAIASMGYYIFPCSESLPRWNTKGFIALQILHVAVSEPLYYVLHRHFHRNKYLFIHYHSLHHSSPVPQIPTAGHATLLEHIVLSAIVAIPILGSSIIGYGSISLIYGYILMFDFLRCLGHCNVEIIPHRWFETFPFLRYLLYTPTYHSLHHTEKDSNFCLFMPLFDALGNTLNSKSWEDHKKITsasgenvrvpDFVFLAHVVDVTASMHPPFVFRSLASLPYSPKLFMLPFWPLAFSAMFALWAWSKTFLISFYWLRGRLHQTWAVPRYGFQYFLPFAQTGINKQIEDAILRADRLGVKVLSLAALNKNESLNGGGTLFVDKHPNLKVRVVHGNTCTAAVIlnelpkdvKEVFLTGATSKLGRAIALYLCRKRVRVLMLTLSTERFQKIQKEAPIDCQNYLVQVTKYQAAQHSKTWIVGKWITPREQNWAPPGTHFHQFVVPPILHFRRDCTYGDLAAMRLPDDVEGLGICEYTMDRGVVHACHAGGVVHLLEGWTHHEVGAIDVDKIDLVWEAALkhgfkpvsslrnrqiss
MDAPLAAWPWDNLGMFKYVLYGPLVGKALYSWVYEDKRIEYWCLHILIISVLRGLIHILWNSFSNMLFLNRARQINQRGVDFKQIDNEWNWDNFILLQAAIASMGYYIFPCSESLPRWNTKGFIALQILHVAVSEPLYYVLHRHFHRNKYLFIHYHSLHHSSPVPQIPTAGHATLLEHIVLSAIVAIPilgssiigygsisliygyilMFDFLRCLGHCNVEIIPHRWFETFPFLRYLLYTPTYHSLHHTEKDSNFCLFMPLFDALGNTLNSKSWEDHKKITSASGENVRVPDFVFLAHVVDVTASMHPPFVFRSLASLPYSPKLFMLPFWPLAFSAMFALWAWSKTFLISFYWLRGRLHQTWAVPRYGFQYFLPFAQTGINKQIEDAILRADRLGVKVLSLAALNKNESLNGGGTLFVDKHPNLKVRVVHGNTCTAAVILNELPKDVKEVFLTGATSKLGRAIALYLCRKRVRVLMLTLSTERFQKIQKEAPIDCQNYLVQVTKYQAAQHSKTWIVGKWITPREQNWAPPGTHFHQFVVPPILHFRRDCTYGDLAAMRLPDDVEGLGICEYTMDRgvvhachaggvvhLLEGWTHHEVGAIDVDKIDLVWEAALKHGFKPVSSLRNRQISS
****LAAWPWDNLGMFKYVLYGPLVGKALYSWVYEDKRIEYWCLHILIISVLRGLIHILWNSFSNMLFLNRARQINQRGVDFKQIDNEWNWDNFILLQAAIASMGYYIFPCSESLPRWNTKGFIALQILHVAVSEPLYYVLHRHFHRNKYLFIHYHSLHHSSPVPQIPTAGHATLLEHIVLSAIVAIPILGSSIIGYGSISLIYGYILMFDFLRCLGHCNVEIIPHRWFETFPFLRYLLYTPTYHSLHHTEKDSNFCLFMPLFDALGNTLNSKSWEDHKKITSASGENVRVPDFVFLAHVVDVTASMHPPFVFRSLASLPYSPKLFMLPFWPLAFSAMFALWAWSKTFLISFYWLRGRLHQTWAVPRYGFQYFLPFAQTGINKQIEDAILRADRLGVKVLSLAALNKNESLNGGGTLFVDKHPNLKVRVVHGNTCTAAVILNELPKDVKEVFLTGATSKLGRAIALYLCRKRVRVLMLTLSTERFQKIQKEAPIDCQNYLVQVTKYQAAQHSKTWIVGKWITPREQNWAPPGTHFHQFVVPPILHFRRDCTYGDLAAMRLPDDVEGLGICEYTMDRGVVHACHAGGVVHLLEGWTHHEVGAIDVDKIDLVWEAALKHGFK************
*DAPLAAWPWDNLGMFKYVLYGPLVGKALYSWVYEDKRIEYWCLHILIISVLRGLIHILWNSFSNMLFLNRARQINQRGVDFKQIDNEWNWDNFILLQAAIASMGYYIFPCSESLPRWNTKGFIALQILHVAVSEPLYYVLHRHFHRNKYLFIHYHSLHHSSPVPQIPTAGHATLLEHIVLSAIVAIPILGSSIIGYGSISLIYGYILMFDFLRCLGHCNVEIIPHRWFETFPFLRYLLYTPTYHSLHHTEKDSNFCLFMPLFDALGNTLNSKSWEDHK********NVRVPDFVFLAHVVDVTASMHPPFVFRSLASLPYSPKLFMLPFWPLAFSAMFALWAWSKTFLISFYWLRGRLHQTWAVPRYGFQYFLPFAQTGINKQIEDAILRADRLGVKVLSLAALNKNESLNGGGTLFVDKHPNLKVRVVHGNTCTAAVILNELPKDVKEVFLTGATSKLGRAIALYLCRKRVRVLMLTLSTER***********CQNYLVQVTKYQAAQHSKTWIVGKWITPREQNWAPPGTHFHQFVVPPILHFRRDCTYGDLAAMRLPDDVEGLGICEYTMDRGVVHACHAGGVVHLLEGWTHHEVGAIDVDKIDLVWEAALKHGFKPVSS*R******
MDAPLAAWPWDNLGMFKYVLYGPLVGKALYSWVYEDKRIEYWCLHILIISVLRGLIHILWNSFSNMLFLNRARQINQRGVDFKQIDNEWNWDNFILLQAAIASMGYYIFPCSESLPRWNTKGFIALQILHVAVSEPLYYVLHRHFHRNKYLFIHYHSLHHSSPVPQIPTAGHATLLEHIVLSAIVAIPILGSSIIGYGSISLIYGYILMFDFLRCLGHCNVEIIPHRWFETFPFLRYLLYTPTYHSLHHTEKDSNFCLFMPLFDALGNTLNSKSWEDHKKITSASGENVRVPDFVFLAHVVDVTASMHPPFVFRSLASLPYSPKLFMLPFWPLAFSAMFALWAWSKTFLISFYWLRGRLHQTWAVPRYGFQYFLPFAQTGINKQIEDAILRADRLGVKVLSLAALNKNESLNGGGTLFVDKHPNLKVRVVHGNTCTAAVILNELPKDVKEVFLTGATSKLGRAIALYLCRKRVRVLMLTLSTERFQKIQKEAPIDCQNYLVQVTKYQAAQHSKTWIVGKWITPREQNWAPPGTHFHQFVVPPILHFRRDCTYGDLAAMRLPDDVEGLGICEYTMDRGVVHACHAGGVVHLLEGWTHHEVGAIDVDKIDLVWEAALKHGFKPV**********
**APLAAWPWDNLGMFKYVLYGPLVGKALYSWVYEDKRIEYWCLHILIISVLRGLIHILWNSFSNMLFLNRARQINQRGVDFKQIDNEWNWDNFILLQAAIASMGYYIFPCSESLPRWNTKGFIALQILHVAVSEPLYYVLHRHFHRNKYLFIHYHSLHHSSPVPQIPTAGHATLLEHIVLSAIVAIPILGSSIIGYGSISLIYGYILMFDFLRCLGHCNVEIIPHRWFETFPFLRYLLYTPTYHSLHHTEKDSNFCLFMPLFDALGNTLNSKSWEDHKKITSASGENVRVPDFVFLAHVVDVTASMHPPFVFRSLASLPYSPKLFMLPFWPLAFSAMFALWAWSKTFLISFYWLRGRLHQTWAVPRYGFQYFLPFAQTGINKQIEDAILRADRLGVKVLSLAALNKNESLNGGGTLFVDKHPNLKVRVVHGNTCTAAVILNELPKDVKEVFLTGATSKLGRAIALYLCRKRVRVLMLTLSTERFQKIQKEAPIDCQNYLVQVTKYQAAQHSKTWIVGKWITPREQNWAPPGTHFHQFVVPPILHFRRDCTYGDLAAMRLPDDVEGLGICEYTMDRGVVHACHAGGVVHLLEGWTHHEVGAIDVDKIDLVWEAALKHGFKPVSSLRNR****
ooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDAPLAAWPWDNLGMFKYVLYGPLVGKALYSWVYEDKRIEYWCLHILIISVLRGLIHILWNSFSNMLFLNRARQINQRGVDFKQIDNEWNWDNFILLQAAIASMGYYIFPCSESLPRWNTKGFIALQILHVAVSEPLYYVLHRHFHRNKYLFIHYHSLHHSSPVPQIPTAGHATLLEHIVLSAIVAIPILGSSIIGYGSISLIYGYILMFDFLRCLGHCNVEIIPHRWFETFPFLRYLLYTPTYHSLHHTEKDSNFCLFMPLFDALGNTLNSKSWEDHKKITSASGENVRVPDFVFLAHVVDVTASMHPPFVFRSLASLPYSPKLFMLPFWPLAFSAMFALWAWSKTFLISFYWLRGRLHQTWAVPRYGFQYFLPFAQTGINKQIEDAILRADRLGVKVLSLAALNKNESLNGGGTLFVDKHPNLKVRVVHGNTCTAAVILNELPKDVKEVFLTGATSKLGRAIALYLCRKRVRVLMLTLSTERFQKIQKEAPIDCQNYLVQVTKYQAAQHSKTWIVGKWITPREQNWAPPGTHFHQFVVPPILHFRRDCTYGDLAAMRLPDDVEGLGICEYTMDRGVVHACHAGGVVHLLEGWTHHEVGAIDVDKIDLVWEAALKHGFKPVSSLRNRQISS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query632 2.2.26 [Sep-21-2011]
Q8H1Z0632 Protein ECERIFERUM 3 OS=A yes no 0.992 0.992 0.704 0.0
F4HVY0625 Protein ECERIFERUM 1 OS=A no no 0.966 0.977 0.361 1e-104
F4HVX7627 Protein CER1-like 1 OS=Ar no no 0.962 0.969 0.347 4e-94
F4IR05613 Protein CER1-like 2 OS=Ar no no 0.943 0.972 0.346 6e-92
>sp|Q8H1Z0|CER3_ARATH Protein ECERIFERUM 3 OS=Arabidopsis thaliana GN=CER3 PE=1 SV=1 Back     alignment and function desciption
 Score =  942 bits (2435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/632 (70%), Positives = 513/632 (81%), Gaps = 5/632 (0%)

Query: 1   MDAPLAAWPWDNLGMFKYVLYGPLVGKALYSWVYE-DKRIEYWCLHILIISVLRGLIHIL 59
           M A L+AWPW+N G  KY+LY PL  + +YSWVYE D     WC+HILII  L+ L+H L
Sbjct: 1   MVAFLSAWPWENFGNLKYLLYAPLAAQVVYSWVYEEDISKVLWCIHILIICGLKALVHEL 60

Query: 60  WNSFSNMLFLNRARQINQRGVDFKQIDNEWNWDNFILLQAAIASMGYYIFP----CSESL 115
           W+ F+NMLF+ R  +IN +G+DFKQID+EW+WDN+I+LQA I S+  Y+ P       SL
Sbjct: 61  WSVFNNMLFVTRTLRINPKGIDFKQIDHEWHWDNYIILQAIIVSLICYMSPPLMMMINSL 120

Query: 116 PRWNTKGFIALQILHVAVSEPLYYVLHRHFHRNKYLFIHYHSLHHSSPVPQIPTAGHATL 175
           P WNTKG IAL +LHV  SEPLYY LHR FHRN Y F HYHS HHSSPVP   TAG+ATL
Sbjct: 121 PLWNTKGLIALIVLHVTFSEPLYYFLHRSFHRNNYFFTHYHSFHHSSPVPHPMTAGNATL 180

Query: 176 LEHIVLSAIVAIPILGSSIIGYGSISLIYGYILMFDFLRCLGHCNVEIIPHRWFETFPFL 235
           LE+I+L  +  +P++G  + G GS+S IYGY +MFDF+RCLGHCNVEI  H+ FE  P L
Sbjct: 181 LENIILCVVAGVPLIGCCLFGVGSLSAIYGYAVMFDFMRCLGHCNVEIFSHKLFEILPVL 240

Query: 236 RYLLYTPTYHSLHHTEKDSNFCLFMPLFDALGNTLNSKSWEDHKKITSASGENVRVPDFV 295
           RYL+YTPTYHSLHH E  +NFCLFMPLFD LG+T N  SWE  KKI  ++GE  RVP+FV
Sbjct: 241 RYLIYTPTYHSLHHQEMGTNFCLFMPLFDVLGDTQNPNSWELQKKIRLSAGERKRVPEFV 300

Query: 296 FLAHVVDVTASMHPPFVFRSLASLPYSPKLFMLPFWPLAFSAMFALWAWSKTFLISFYWL 355
           FLAH VDV ++MH PFVFRS AS+PY+ ++F+LP WP  F  M  +WAWSKTFL SFY L
Sbjct: 301 FLAHGVDVMSAMHAPFVFRSFASMPYTTRIFLLPMWPFTFCVMLGMWAWSKTFLFSFYTL 360

Query: 356 RGRLHQTWAVPRYGFQYFLPFAQTGINKQIEDAILRADRLGVKVLSLAALNKNESLNGGG 415
           R  L QTW VPR+GFQYFLPFA  GIN QIE AILRAD++GVKV+SLAALNKNE+LNGGG
Sbjct: 361 RNNLCQTWGVPRFGFQYFLPFATKGINDQIEAAILRADKIGVKVISLAALNKNEALNGGG 420

Query: 416 TLFVDKHPNLKVRVVHGNTCTAAVILNELPKDVKEVFLTGATSKLGRAIALYLCRKRVRV 475
           TLFV+KHP+L+VRVVHGNT TAAVIL E+PKDV EVFLTGATSKLGRAIALYLCR+ VRV
Sbjct: 421 TLFVNKHPDLRVRVVHGNTLTAAVILYEIPKDVNEVFLTGATSKLGRAIALYLCRRGVRV 480

Query: 476 LMLTLSTERFQKIQKEAPIDCQNYLVQVTKYQAAQHSKTWIVGKWITPREQNWAPPGTHF 535
           LMLTLS ERFQKIQKEAP++ QN LVQVTKY AAQH KTWIVGKW+TPREQ+WAP GTHF
Sbjct: 481 LMLTLSMERFQKIQKEAPVEFQNNLVQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHF 540

Query: 536 HQFVVPPILHFRRDCTYGDLAAMRLPDDVEGLGICEYTMDRGVVHACHAGGVVHLLEGWT 595
           HQFVVPPIL FRR+CTYGDLAAM+LP DVEGLG CEYTM+RGVVHACHAGGVVH+LEGW 
Sbjct: 541 HQFVVPPILKFRRNCTYGDLAAMKLPKDVEGLGTCEYTMERGVVHACHAGGVVHMLEGWK 600

Query: 596 HHEVGAIDVDKIDLVWEAALKHGFKPVSSLRN 627
           HHEVGAIDVD+IDLVWEAA+K+G   VSSL N
Sbjct: 601 HHEVGAIDVDRIDLVWEAAMKYGLSAVSSLTN 632




Involved in cuticule membrane and wax production, and in the typhine and sopropollenin biosynthesis of pollen. May act as an aldehyde-generating acyl-CoA reductase.
Arabidopsis thaliana (taxid: 3702)
>sp|F4HVY0|CER1_ARATH Protein ECERIFERUM 1 OS=Arabidopsis thaliana GN=CER1 PE=1 SV=1 Back     alignment and function description
>sp|F4HVX7|CERL1_ARATH Protein CER1-like 1 OS=Arabidopsis thaliana GN=At1g02190 PE=2 SV=1 Back     alignment and function description
>sp|F4IR05|CERL2_ARATH Protein CER1-like 2 OS=Arabidopsis thaliana GN=At2g37700 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query632
225445726632 PREDICTED: protein WAX2 isoform 2 [Vitis 0.982 0.982 0.754 0.0
225445728630 PREDICTED: protein WAX2 isoform 1 [Vitis 0.979 0.982 0.750 0.0
356562514632 PREDICTED: protein WAX2-like [Glycine ma 0.993 0.993 0.729 0.0
356547835629 PREDICTED: protein WAX2-like [Glycine ma 0.987 0.992 0.740 0.0
297793287632 hypothetical protein ARALYDRAFT_495876 [ 0.992 0.992 0.707 0.0
312281577631 unnamed protein product [Thellungiella h 0.992 0.993 0.714 0.0
224143851652 predicted protein [Populus trichocarpa] 0.985 0.955 0.702 0.0
30696940632 protein WAX2 [Arabidopsis thaliana] gi|7 0.992 0.992 0.704 0.0
224088374633 predicted protein [Populus trichocarpa] 0.996 0.995 0.715 0.0
449464324625 PREDICTED: protein ECERIFERUM 3-like [Cu 0.987 0.998 0.729 0.0
>gi|225445726|ref|XP_002270946.1| PREDICTED: protein WAX2 isoform 2 [Vitis vinifera] gi|297743728|emb|CBI36611.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1000 bits (2585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/622 (75%), Positives = 542/622 (87%), Gaps = 1/622 (0%)

Query: 3   APLAAWPWDNLGMFKYVLYGPLVGKALYSWVYEDKRIEYWCLHILIISVLRGLIHILWNS 62
           A L+AWPW+NLG FKY+LYGP +GK LYS  +ED + + WCLHILI+  LRGLIH  W S
Sbjct: 5   AVLSAWPWENLGTFKYLLYGPFIGKLLYSKFHEDAQTDTWCLHILILCALRGLIHQSWCS 64

Query: 63  FSNMLFLNRARQINQRGVDFKQIDNEWNWDNFILLQAAIASMGYYIFPCSESLPRWNTKG 122
           +SNMLFL R R+I ++GVDFKQID EW+WDNFILLQA IAS+ +YIFP    LP WNT+G
Sbjct: 65  YSNMLFLTRNRRIQKQGVDFKQIDREWDWDNFILLQALIASVAFYIFPFLSDLPVWNTRG 124

Query: 123 FIALQILHVAVSEPLYYVLHRHFHRNKYLFIHYHSLHHSSPVPQIPTAGHATLLEHIVLS 182
            IA  ILH+ VSEPLYY +HR FH N YLF  YHSLHH+S V Q  TAG AT LEH++LS
Sbjct: 125 VIAALILHIGVSEPLYYWVHRCFHGN-YLFTRYHSLHHASTVTQSFTAGSATFLEHLILS 183

Query: 183 AIVAIPILGSSIIGYGSISLIYGYILMFDFLRCLGHCNVEIIPHRWFETFPFLRYLLYTP 242
           A+V IP+LGSS++G+GSIS+IYGY+L+FDFLRCLGH NVE++PH  F  FPFL+YL+YTP
Sbjct: 184 AVVGIPVLGSSLMGFGSISMIYGYVLIFDFLRCLGHSNVEVVPHAMFHAFPFLKYLIYTP 243

Query: 243 TYHSLHHTEKDSNFCLFMPLFDALGNTLNSKSWEDHKKITSASGENVRVPDFVFLAHVVD 302
           TYHSLHHTE  +NFCLFMPLFDALGNT+N KSWE HKKITS +G+  RVPDFVFLAHVVD
Sbjct: 244 TYHSLHHTEMGTNFCLFMPLFDALGNTMNCKSWELHKKITSDTGKYGRVPDFVFLAHVVD 303

Query: 303 VTASMHPPFVFRSLASLPYSPKLFMLPFWPLAFSAMFALWAWSKTFLISFYWLRGRLHQT 362
           V +++H PFVFRS  SLP++ ++F+LP WP AF  M  +WAWSKTFL++FY LRGRLHQT
Sbjct: 304 VISALHVPFVFRSFGSLPFATRIFLLPLWPQAFVIMLLMWAWSKTFLVTFYNLRGRLHQT 363

Query: 363 WAVPRYGFQYFLPFAQTGINKQIEDAILRADRLGVKVLSLAALNKNESLNGGGTLFVDKH 422
           WAVPR+GFQYFLPFA  GIN QIE AILRADRLGVKV+SLAALNKNE+LNGGGTLFVDKH
Sbjct: 364 WAVPRFGFQYFLPFATEGINNQIEQAILRADRLGVKVISLAALNKNEALNGGGTLFVDKH 423

Query: 423 PNLKVRVVHGNTCTAAVILNELPKDVKEVFLTGATSKLGRAIALYLCRKRVRVLMLTLST 482
           PNLKVRVVHGNT TAAVIL+E+P+ VKEVFLTGATSKLGRAIALYLC+++VRVLMLTLST
Sbjct: 424 PNLKVRVVHGNTLTAAVILHEIPQGVKEVFLTGATSKLGRAIALYLCQRKVRVLMLTLST 483

Query: 483 ERFQKIQKEAPIDCQNYLVQVTKYQAAQHSKTWIVGKWITPREQNWAPPGTHFHQFVVPP 542
           ERFQKIQ+EAP++ QNYLVQVTKYQAAQ+ KTWIVGKWITPR+QNWAP G HFHQFVVPP
Sbjct: 484 ERFQKIQREAPVEFQNYLVQVTKYQAAQNCKTWIVGKWITPRQQNWAPSGAHFHQFVVPP 543

Query: 543 ILHFRRDCTYGDLAAMRLPDDVEGLGICEYTMDRGVVHACHAGGVVHLLEGWTHHEVGAI 602
           IL FRRDCTYGDLAA++LP+DV+GLG CEYTM+RGVVHACHAGGVVH+LEGWTHHEVGA+
Sbjct: 544 ILPFRRDCTYGDLAALKLPEDVQGLGSCEYTMERGVVHACHAGGVVHVLEGWTHHEVGAL 603

Query: 603 DVDKIDLVWEAALKHGFKPVSS 624
           DVD+ID+VW+AALKHG KPV+ 
Sbjct: 604 DVDRIDVVWKAALKHGLKPVNE 625




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225445728|ref|XP_002270904.1| PREDICTED: protein WAX2 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356562514|ref|XP_003549515.1| PREDICTED: protein WAX2-like [Glycine max] Back     alignment and taxonomy information
>gi|356547835|ref|XP_003542310.1| PREDICTED: protein WAX2-like [Glycine max] Back     alignment and taxonomy information
>gi|297793287|ref|XP_002864528.1| hypothetical protein ARALYDRAFT_495876 [Arabidopsis lyrata subsp. lyrata] gi|297310363|gb|EFH40787.1| hypothetical protein ARALYDRAFT_495876 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|312281577|dbj|BAJ33654.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|224143851|ref|XP_002325096.1| predicted protein [Populus trichocarpa] gi|222866530|gb|EEF03661.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|30696940|ref|NP_200588.2| protein WAX2 [Arabidopsis thaliana] gi|75151993|sp|Q8H1Z0.1|CER3_ARATH RecName: Full=Protein ECERIFERUM 3; AltName: Full=Protein FACELESS POLLEN 1; AltName: Full=Protein WAX2; AltName: Full=Protein YORE-YORE gi|22900949|gb|AAN06975.1| cuticle protein [Arabidopsis thaliana] gi|37051339|dbj|BAC81644.1| YORE-YORE protein [Arabidopsis thaliana] gi|40714041|dbj|BAD06945.1| faceless pollen-1 [Arabidopsis thaliana] gi|332009570|gb|AED96953.1| protein WAX2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224088374|ref|XP_002308430.1| predicted protein [Populus trichocarpa] gi|222854406|gb|EEE91953.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449464324|ref|XP_004149879.1| PREDICTED: protein ECERIFERUM 3-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query632
TAIR|locus:2174368632 CER3 "ECERIFERUM 3" [Arabidops 0.992 0.992 0.667 5.4e-237
UNIPROTKB|Q6ETL8628 P0544B02.10 "Os02g0178800 prot 0.973 0.979 0.592 1.3e-201
UNIPROTKB|Q7XDI3621 Os10g0471100 "CER1 protein, pu 0.957 0.974 0.335 6.1e-94
TAIR|locus:2204813627 AT1G02190 "AT1G02190" [Arabido 0.960 0.968 0.327 1.6e-88
UNIPROTKB|Q109K1595 LOC_Os10g33250 "CER1 protein, 0.723 0.768 0.319 1.9e-87
TAIR|locus:2040666613 AT2G37700 "AT2G37700" [Arabido 0.941 0.970 0.331 2.6e-86
TAIR|locus:2174368 CER3 "ECERIFERUM 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2285 (809.4 bits), Expect = 5.4e-237, P = 5.4e-237
 Identities = 422/632 (66%), Positives = 487/632 (77%)

Query:     1 MDAPLAAWPWDNLGMFKYVLYGPLVGKALYSWVYEDKRIEY-WCLHILIISVLRGLIHIL 59
             M A L+AWPW+N G  KY+LY PL  + +YSWVYE+   +  WC+HILII  L+ L+H L
Sbjct:     1 MVAFLSAWPWENFGNLKYLLYAPLAAQVVYSWVYEEDISKVLWCIHILIICGLKALVHEL 60

Query:    60 WNSFSNMLFLNRARQINQRGVDFKQIDNEWNWDNFILLQAAIASMGYYIFP----CSESL 115
             W+ F+NMLF+ R  +IN +G+DFKQID+EW+WDN+I+LQA I S+  Y+ P       SL
Sbjct:    61 WSVFNNMLFVTRTLRINPKGIDFKQIDHEWHWDNYIILQAIIVSLICYMSPPLMMMINSL 120

Query:   116 PRWNTKGFIALQILHVAVSEPLYYVLHRHFHRNKYLFIHYHSLHHSSPVPQIPTAGHATL 175
             P WNTKG IAL +LHV  SEPLYY LHR FHRN Y F HYHS HHSSPVP   TAG+ATL
Sbjct:   121 PLWNTKGLIALIVLHVTFSEPLYYFLHRSFHRNNYFFTHYHSFHHSSPVPHPMTAGNATL 180

Query:   176 LEHIVLSAIVAIPXXXXXXXXXXXXXXXXXXXXMFDFLRCLGHCNVEIIPHRWFETFPFL 235
             LE+I+L  +  +P                    MFDF+RCLGHCNVEI  H+ FE  P L
Sbjct:   181 LENIILCVVAGVPLIGCCLFGVGSLSAIYGYAVMFDFMRCLGHCNVEIFSHKLFEILPVL 240

Query:   236 RYLLYTPTYHSLHHTEKDSNFCLFMPLFDALGNTLNSKSWEDHKKITSASGENVRVPDFV 295
             RYL+YTPTYHSLHH E  +NFCLFMPLFD LG+T N  SWE  KKI  ++GE  RVP+FV
Sbjct:   241 RYLIYTPTYHSLHHQEMGTNFCLFMPLFDVLGDTQNPNSWELQKKIRLSAGERKRVPEFV 300

Query:   296 FLAHVVDVTASMHPPFVFRSLASLPYSPKLFMLPFWPLAFSAMFALWAWSKTFLISFYWL 355
             FLAH VDV ++MH PFVFRS AS+PY+ ++F+LP WP  F  M  +WAWSKTFL SFY L
Sbjct:   301 FLAHGVDVMSAMHAPFVFRSFASMPYTTRIFLLPMWPFTFCVMLGMWAWSKTFLFSFYTL 360

Query:   356 RGRLHQTWAVPRYGFQYFLPFAQTGINKQIEDAILRADRLGVKVLSLAALNKNESLNGGG 415
             R  L QTW VPR+GFQYFLPFA  GIN QIE AILRAD++GVKV+SLAALNKNE+LNGGG
Sbjct:   361 RNNLCQTWGVPRFGFQYFLPFATKGINDQIEAAILRADKIGVKVISLAALNKNEALNGGG 420

Query:   416 TLFVDKHPNLKVRVVHGNTCTAAVILNELPKDVKEVFLTGATSKLGRAIALYLCRKRVRV 475
             TLFV+KHP+L+VRVVHGNT TAAVIL E+PKDV EVFLTGATSKLGRAIALYLCR+ VRV
Sbjct:   421 TLFVNKHPDLRVRVVHGNTLTAAVILYEIPKDVNEVFLTGATSKLGRAIALYLCRRGVRV 480

Query:   476 LMLTLSTERFQKIQKEAPIDCQNYLVQVTKYQAAQHSKTWIVGKWITPREQNWAPPGTHF 535
             LMLTLS ERFQKIQKEAP++ QN LVQVTKY AAQH KTWIVGKW+TPREQ+WAP GTHF
Sbjct:   481 LMLTLSMERFQKIQKEAPVEFQNNLVQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHF 540

Query:   536 HQFVVPPILHFRRDCTYGDLAAMRLPDDVEGLGICEYTMDRXXXXXXXXXXXXXLLEGWT 595
             HQFVVPPIL FRR+CTYGDLAAM+LP DVEGLG CEYTM+R             +LEGW 
Sbjct:   541 HQFVVPPILKFRRNCTYGDLAAMKLPKDVEGLGTCEYTMERGVVHACHAGGVVHMLEGWK 600

Query:   596 HHEVGAIDVDKIDLVWEAALKHGFKPVSSLRN 627
             HHEVGAIDVD+IDLVWEAA+K+G   VSSL N
Sbjct:   601 HHEVGAIDVDRIDLVWEAAMKYGLSAVSSLTN 632




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=ISS
GO:0005506 "iron ion binding" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0010025 "wax biosynthetic process" evidence=IMP
GO:0016020 "membrane" evidence=ISS
GO:0042335 "cuticle development" evidence=RCA;IMP
GO:0048235 "pollen sperm cell differentiation" evidence=IMP
GO:0005886 "plasma membrane" evidence=IDA
GO:0006723 "cuticle hydrocarbon biosynthetic process" evidence=IMP
GO:0000038 "very long-chain fatty acid metabolic process" evidence=RCA
GO:0043447 "alkane biosynthetic process" evidence=IDA
UNIPROTKB|Q6ETL8 P0544B02.10 "Os02g0178800 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q7XDI3 Os10g0471100 "CER1 protein, putative, expressed" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2204813 AT1G02190 "AT1G02190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q109K1 LOC_Os10g33250 "CER1 protein, putative, expressed" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2040666 AT2G37700 "AT2G37700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8H1Z0CER3_ARATHNo assigned EC number0.70410.99200.9920yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query632
PLN02869620 PLN02869, PLN02869, fatty aldehyde decarbonylase 1e-144
pfam12076164 pfam12076, Wax2_C, WAX2 C-terminal domain 4e-84
COG3000271 COG3000, ERG3, Sterol desaturase [Lipid metabolism 5e-14
pfam04116114 pfam04116, FA_hydroxylase, Fatty acid hydroxylase 5e-14
cd05356239 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxyst 0.004
>gnl|CDD|166510 PLN02869, PLN02869, fatty aldehyde decarbonylase Back     alignment and domain information
 Score =  431 bits (1110), Expect = e-144
 Identities = 237/624 (37%), Positives = 342/624 (54%), Gaps = 21/624 (3%)

Query: 5   LAAWPWDNLGMFKYVLYGPLVGKALYSWVYEDKRIEYWCLHILIISVL--RGLIHILWNS 62
           L  WPW  LG FKYV+  P V  ++YS+V +D++ E    + LI   L  R L + LW S
Sbjct: 8   LTDWPWKPLGSFKYVVLAPWVIHSIYSFVVKDEK-ERDLSYFLIFPFLLWRMLHNQLWIS 66

Query: 63  FSNMLFLNRARQINQRGVDFKQIDNEWNWDNFILLQAAIASMGYYIFPCSESLPRWNTKG 122
            S         +I  +G++F+Q+D E NWD+ IL    +  +GY I P +  +P W T G
Sbjct: 67  LSRYRTAKGNNRIVDKGIEFEQVDRERNWDDQILFNGILFYVGYMILPGASHMPLWRTDG 126

Query: 123 FIALQILHVAVSEPLYYVLHRHFHRNKYLFIHYHSLHHSSPVPQIPTAGHATLLEHIVLS 182
            +   +LH+   E LYY LHR  H + YL+  YHS HHSS V +  T+      EHI   
Sbjct: 127 VLITILLHMGPVEFLYYWLHRALHHH-YLYSRYHSHHHSSIVTEPITSVIHPFAEHIAYF 185

Query: 183 AIVAIPILGSSIIGYGSISLIYGYILMFDFLRCLGHCNVEIIPHRWFETFPFLRYLLYTP 242
            + AIP+L +   G  SI+  +GYI   DF+  +GHCN E+IP   F  FP L+YL+YTP
Sbjct: 186 LLFAIPLLTTIFTGTASIAAFFGYISYIDFMNNMGHCNFELIPKWLFSIFPPLKYLMYTP 245

Query: 243 TYHSLHHTEKDSNFCLFMPLFDALGNTLNSKSWEDHKKITSASGENVRVPDFVFLAHVVD 302
           +YHSLHHT+  +N+ LFMP++D +  T++  S   ++K      E   +PD V L H+  
Sbjct: 246 SYHSLHHTQFRTNYSLFMPIYDYIYGTMDKSSDTLYEKSLKRPEE---IPDVVHLTHLTT 302

Query: 303 VTASMHPPFVFRSLASLPYSPKLFMLPFWPLAFSAMFALWAWSKTFLISFYWLRGRLH-- 360
             +  H    F SLAS PY  K ++   WP+   +M   W + +TF++     R R +  
Sbjct: 303 PDSIYHLRLGFASLASKPYISKWYLRLMWPVTSWSMMLTWIYGRTFVLE----RNRFNKL 358

Query: 361 --QTWAVPRYGFQYFLPFAQTGINKQIEDAILRADRLGVKVLSLAALNKNESLNGGGTLF 418
             QTW +P+Y  QY L +    IN  IE+AIL AD+ GVKVLSL  LN+ E LN  G L+
Sbjct: 359 NLQTWVIPKYKIQYLLKWQNESINSLIEEAILEADKRGVKVLSLGLLNQGEELNRYGELY 418

Query: 419 VDKHPNLKVRVVHGNTCTAAVILNELPKDVKEVFLTGATSKLGRAIALYLCRKRVRVLML 478
           + ++P LK++VV G++   AV+LN +PK   +V   G  SK+   IA  LC++ ++V   
Sbjct: 419 IHRNPKLKIKVVDGSSLAVAVVLNSIPKGTTQVLFRGNLSKVAYFIASALCQRGIQV--A 476

Query: 479 TLSTERFQKIQKEAPIDCQNYLVQVTKYQAAQHSKTWIVGKWITPREQNWAPPGTHFHQF 538
           T   + ++K+ K+ P       + ++K  +    K W+VG  +T  EQ  A  GT F  F
Sbjct: 477 TFREDEYEKLNKKLPNTECGSKLLLSKNYS---EKIWLVGDGLTEEEQKKASKGTLFIPF 533

Query: 539 VVPPILHFRRDCTYGDLAAMRLPDDVEGLGICEYTMDRGVVHACHAGGVVHLLEGWTHHE 598
              P    R+DC Y    AM  P   E +  CE  + R  + A    G++H LEGW  HE
Sbjct: 534 SQFPPKRLRKDCFYHTTPAMMSPKSFENVDSCENWLPRRAMSAWRVAGILHALEGWNVHE 593

Query: 599 VGAIDVDKIDLVWEAALKHGFKPV 622
            G    D I+ +WEA+L+HGF+P+
Sbjct: 594 CGYTMFD-IEKIWEASLQHGFRPL 616


Length = 620

>gnl|CDD|192933 pfam12076, Wax2_C, WAX2 C-terminal domain Back     alignment and domain information
>gnl|CDD|225546 COG3000, ERG3, Sterol desaturase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|217907 pfam04116, FA_hydroxylase, Fatty acid hydroxylase superfamily Back     alignment and domain information
>gnl|CDD|187614 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxysteroid dehydrogenases (17beta-HSDs) types -1, -3, and -12, -like, classical (c) SDRs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 632
PLN02869620 fatty aldehyde decarbonylase 100.0
PF12076164 Wax2_C: WAX2 C-terminal domain; InterPro: IPR02194 100.0
KOG0873283 consensus C-4 sterol methyl oxidase [Lipid transpo 100.0
PRK14982340 acyl-ACP reductase; Provisional 100.0
KOG0872312 consensus Sterol C5 desaturase [Lipid transport an 99.95
COG3000271 ERG3 Sterol desaturase [Lipid metabolism] 99.95
COG5322351 Predicted dehydrogenase [General function predicti 99.89
KOG0874287 consensus Sphingolipid hydroxylase [Lipid transpor 99.88
PF04116114 FA_hydroxylase: Fatty acid hydroxylase superfamily 99.71
PRK12548289 shikimate 5-dehydrogenase; Provisional 99.54
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 99.49
PRK14027283 quinate/shikimate dehydrogenase; Provisional 99.46
PRK12549284 shikimate 5-dehydrogenase; Reviewed 99.45
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 99.42
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 99.4
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 99.37
PRK12550272 shikimate 5-dehydrogenase; Reviewed 99.35
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 99.35
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 99.34
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.29
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 99.17
COG0300265 DltE Short-chain dehydrogenases of various substra 99.13
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 99.13
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 99.1
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.09
PLN02434237 fatty acid hydroxylase 98.99
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 98.87
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 98.83
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 98.83
PRK08339263 short chain dehydrogenase; Provisional 98.79
KOG0725270 consensus Reductases with broad range of substrate 98.79
KOG1208314 consensus Dehydrogenases with different specificit 98.79
KOG1014312 consensus 17 beta-hydroxysteroid dehydrogenase typ 98.71
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 98.71
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 98.65
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 98.63
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 98.59
PRK05854 313 short chain dehydrogenase; Provisional 98.59
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 98.58
PRK08265261 short chain dehydrogenase; Provisional 98.56
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 98.55
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 98.55
PRK08862227 short chain dehydrogenase; Provisional 98.53
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 98.53
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 98.51
PRK05717255 oxidoreductase; Validated 98.5
PRK06139 330 short chain dehydrogenase; Provisional 98.5
PRK06484520 short chain dehydrogenase; Validated 98.49
PRK05867253 short chain dehydrogenase; Provisional 98.49
PRK06196 315 oxidoreductase; Provisional 98.49
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 98.49
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 98.48
PRK05872 296 short chain dehydrogenase; Provisional 98.47
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 98.47
PRK07825273 short chain dehydrogenase; Provisional 98.46
PRK07063260 short chain dehydrogenase; Provisional 98.45
PRK07062265 short chain dehydrogenase; Provisional 98.44
PRK07478254 short chain dehydrogenase; Provisional 98.43
PRK07067257 sorbitol dehydrogenase; Provisional 98.42
PRK05866293 short chain dehydrogenase; Provisional 98.42
PRK07523255 gluconate 5-dehydrogenase; Provisional 98.41
PRK05876275 short chain dehydrogenase; Provisional 98.41
PRK08589272 short chain dehydrogenase; Validated 98.41
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 98.41
PLN02780320 ketoreductase/ oxidoreductase 98.4
PRK07109 334 short chain dehydrogenase; Provisional 98.39
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 98.39
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 98.39
PRK08303305 short chain dehydrogenase; Provisional 98.38
PRK06101240 short chain dehydrogenase; Provisional 98.38
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 98.37
PRK07453 322 protochlorophyllide oxidoreductase; Validated 98.37
PRK08085254 gluconate 5-dehydrogenase; Provisional 98.37
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 98.37
KOG1478 341 consensus 3-keto sterol reductase [Lipid transport 98.36
PRK07024257 short chain dehydrogenase; Provisional 98.36
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 98.36
PRK06197 306 short chain dehydrogenase; Provisional 98.36
PLN02253280 xanthoxin dehydrogenase 98.36
PRK06720169 hypothetical protein; Provisional 98.35
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.34
PRK09186256 flagellin modification protein A; Provisional 98.34
PRK07890258 short chain dehydrogenase; Provisional 98.34
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 98.34
PRK06138252 short chain dehydrogenase; Provisional 98.33
PRK07097265 gluconate 5-dehydrogenase; Provisional 98.33
PRK06500249 short chain dehydrogenase; Provisional 98.33
PRK06194287 hypothetical protein; Provisional 98.32
PRK06125259 short chain dehydrogenase; Provisional 98.32
PRK06124256 gluconate 5-dehydrogenase; Provisional 98.31
PRK09072263 short chain dehydrogenase; Provisional 98.31
PRK07791286 short chain dehydrogenase; Provisional 98.31
PRK05599246 hypothetical protein; Provisional 98.31
PRK07035252 short chain dehydrogenase; Provisional 98.31
PRK06484 520 short chain dehydrogenase; Validated 98.3
PRK08340259 glucose-1-dehydrogenase; Provisional 98.3
PRK06180277 short chain dehydrogenase; Provisional 98.29
PRK07904253 short chain dehydrogenase; Provisional 98.29
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 98.29
PRK07677252 short chain dehydrogenase; Provisional 98.29
PRK08267260 short chain dehydrogenase; Provisional 98.28
PRK07814263 short chain dehydrogenase; Provisional 98.28
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.28
PRK06949258 short chain dehydrogenase; Provisional 98.27
PRK09242257 tropinone reductase; Provisional 98.27
PRK08277278 D-mannonate oxidoreductase; Provisional 98.26
PRK08643256 acetoin reductase; Validated 98.26
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 98.26
PRK06172253 short chain dehydrogenase; Provisional 98.26
PRK10538248 malonic semialdehyde reductase; Provisional 98.25
PRK06057255 short chain dehydrogenase; Provisional 98.25
PRK06924251 short chain dehydrogenase; Provisional 98.25
PRK08251248 short chain dehydrogenase; Provisional 98.25
PRK08213259 gluconate 5-dehydrogenase; Provisional 98.24
PRK06482276 short chain dehydrogenase; Provisional 98.24
PRK05993277 short chain dehydrogenase; Provisional 98.24
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 98.24
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.23
PRK08628258 short chain dehydrogenase; Provisional 98.23
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 98.23
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 98.23
PRK08263275 short chain dehydrogenase; Provisional 98.23
PRK07102243 short chain dehydrogenase; Provisional 98.22
PRK07576264 short chain dehydrogenase; Provisional 98.22
PRK07774250 short chain dehydrogenase; Provisional 98.22
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 98.22
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 98.21
PRK06114254 short chain dehydrogenase; Provisional 98.21
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 98.21
KOG1610 322 consensus Corticosteroid 11-beta-dehydrogenase and 98.21
PRK06182273 short chain dehydrogenase; Validated 98.19
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 98.18
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.18
PRK06841255 short chain dehydrogenase; Provisional 98.18
PRK06483236 dihydromonapterin reductase; Provisional 98.17
PRK05884223 short chain dehydrogenase; Provisional 98.17
PRK12939250 short chain dehydrogenase; Provisional 98.17
PRK07454241 short chain dehydrogenase; Provisional 98.16
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 98.16
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 98.16
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.15
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 98.15
PRK05875276 short chain dehydrogenase; Provisional 98.15
PRK07831262 short chain dehydrogenase; Provisional 98.15
PRK07326237 short chain dehydrogenase; Provisional 98.14
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.14
PRK12828239 short chain dehydrogenase; Provisional 98.13
PRK07856252 short chain dehydrogenase; Provisional 98.13
PRK07074257 short chain dehydrogenase; Provisional 98.13
PRK12747252 short chain dehydrogenase; Provisional 98.12
PRK08936261 glucose-1-dehydrogenase; Provisional 98.1
KOG1199260 consensus Short-chain alcohol dehydrogenase/3-hydr 98.1
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 98.1
PRK12746254 short chain dehydrogenase; Provisional 98.1
PRK12742237 oxidoreductase; Provisional 98.09
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 98.09
PRK07985294 oxidoreductase; Provisional 98.09
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 98.09
PRK06914280 short chain dehydrogenase; Provisional 98.08
PRK07832272 short chain dehydrogenase; Provisional 98.08
PRK07060245 short chain dehydrogenase; Provisional 98.08
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.07
PRK12743256 oxidoreductase; Provisional 98.07
PRK09291257 short chain dehydrogenase; Provisional 98.06
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 98.06
PRK05650270 short chain dehydrogenase; Provisional 98.06
PRK12829264 short chain dehydrogenase; Provisional 98.06
PRK06398258 aldose dehydrogenase; Validated 98.05
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.05
PRK06940275 short chain dehydrogenase; Provisional 98.04
PRK05693274 short chain dehydrogenase; Provisional 98.04
PRK07806248 short chain dehydrogenase; Provisional 98.04
TIGR02415254 23BDH acetoin reductases. One member of this famil 98.04
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.04
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 98.04
PRK08278273 short chain dehydrogenase; Provisional 98.04
PRK08264238 short chain dehydrogenase; Validated 98.04
PRK07201657 short chain dehydrogenase; Provisional 98.03
COG1028251 FabG Dehydrogenases with different specificities ( 98.03
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.03
PRK07775274 short chain dehydrogenase; Provisional 98.03
PRK06179270 short chain dehydrogenase; Provisional 98.02
PRK09134258 short chain dehydrogenase; Provisional 98.02
PLN03209 576 translocon at the inner envelope of chloroplast su 98.02
PRK08226263 short chain dehydrogenase; Provisional 98.01
PRK05855582 short chain dehydrogenase; Validated 98.01
PRK06523260 short chain dehydrogenase; Provisional 98.01
PRK06128300 oxidoreductase; Provisional 98.01
PLN00015 308 protochlorophyllide reductase 98.0
PRK08703239 short chain dehydrogenase; Provisional 97.99
PRK06181263 short chain dehydrogenase; Provisional 97.99
PRK08177225 short chain dehydrogenase; Provisional 97.99
PRK07041230 short chain dehydrogenase; Provisional 97.98
PRK08017256 oxidoreductase; Provisional 97.97
PRK12938246 acetyacetyl-CoA reductase; Provisional 97.97
PRK06198260 short chain dehydrogenase; Provisional 97.97
PRK12367245 short chain dehydrogenase; Provisional 97.96
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.96
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 97.95
PRK06701290 short chain dehydrogenase; Provisional 97.95
PRK12744257 short chain dehydrogenase; Provisional 97.94
PRK09135249 pteridine reductase; Provisional 97.94
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 97.93
PRK06947248 glucose-1-dehydrogenase; Provisional 97.92
PRK12937245 short chain dehydrogenase; Provisional 97.91
PRK06123248 short chain dehydrogenase; Provisional 97.91
PRK08324681 short chain dehydrogenase; Validated 97.91
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.89
PRK06953222 short chain dehydrogenase; Provisional 97.89
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 97.88
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 97.88
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.88
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 97.88
PRK07023243 short chain dehydrogenase; Provisional 97.87
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 97.87
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.87
PRK12935247 acetoacetyl-CoA reductase; Provisional 97.85
KOG1210 331 consensus Predicted 3-ketosphinganine reductase [S 97.83
PRK07069251 short chain dehydrogenase; Validated 97.83
PRK12827249 short chain dehydrogenase; Provisional 97.82
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.81
KOG0539240 consensus Sphingolipid fatty acid hydroxylase [Lip 97.8
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 97.8
PLN02583 297 cinnamoyl-CoA reductase 97.79
PRK08219227 short chain dehydrogenase; Provisional 97.77
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 97.77
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.75
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 97.72
PRK12824245 acetoacetyl-CoA reductase; Provisional 97.69
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 97.68
PRK08309177 short chain dehydrogenase; Provisional 97.65
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.64
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 97.63
PRK13940414 glutamyl-tRNA reductase; Provisional 97.62
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 97.62
PLN02896 353 cinnamyl-alcohol dehydrogenase 97.61
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.61
PRK07577234 short chain dehydrogenase; Provisional 97.59
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 97.58
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 97.54
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.53
PRK08291330 ectoine utilization protein EutC; Validated 97.53
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 97.51
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 97.51
PLN02686 367 cinnamoyl-CoA reductase 97.49
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 97.48
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 97.47
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 97.47
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 97.46
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 97.43
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 97.41
smart00822180 PKS_KR This enzymatic domain is part of bacterial 97.37
PLN02601303 beta-carotene hydroxylase 97.37
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.37
PLN00203519 glutamyl-tRNA reductase 97.31
PLN00198 338 anthocyanidin reductase; Provisional 97.31
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.29
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 97.28
PLN02653 340 GDP-mannose 4,6-dehydratase 97.28
PLN02572 442 UDP-sulfoquinovose synthase 97.27
PLN02650 351 dihydroflavonol-4-reductase 97.25
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 97.23
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 97.2
PRK07578199 short chain dehydrogenase; Provisional 97.18
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 97.18
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 97.17
PLN02240 352 UDP-glucose 4-epimerase 97.15
PLN02214 342 cinnamoyl-CoA reductase 97.15
PRK06300 299 enoyl-(acyl carrier protein) reductase; Provisiona 97.15
PRK09009235 C factor cell-cell signaling protein; Provisional 97.09
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.01
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 96.98
CHL00194 317 ycf39 Ycf39; Provisional 96.98
PLN02427 386 UDP-apiose/xylose synthase 96.93
PF02719 293 Polysacc_synt_2: Polysaccharide biosynthesis prote 96.91
KOG1502 327 consensus Flavonol reductase/cinnamoyl-CoA reducta 96.85
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 96.84
KOG1611249 consensus Predicted short chain-type dehydrogenase 96.82
COG0623259 FabI Enoyl-[acyl-carrier-protein] 96.77
COG2085211 Predicted dinucleotide-binding enzymes [General fu 96.75
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 96.73
PRK08306296 dipicolinate synthase subunit A; Reviewed 96.63
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 96.6
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 96.59
PRK10675 338 UDP-galactose-4-epimerase; Provisional 96.58
PRK07340304 ornithine cyclodeaminase; Validated 96.51
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 96.48
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 96.45
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 96.41
TIGR01181 317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 96.35
PRK08618325 ornithine cyclodeaminase; Validated 96.33
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 96.32
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.28
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 96.28
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 96.27
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 96.2
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.18
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.13
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 96.13
KOG1371 343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 96.07
PTZ00075476 Adenosylhomocysteinase; Provisional 96.05
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 95.94
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 95.87
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 95.84
PLN02494477 adenosylhomocysteinase 95.8
TIGR01746 367 Thioester-redct thioester reductase domain. It has 95.78
PRK06141314 ornithine cyclodeaminase; Validated 95.77
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.74
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 95.69
PLN02695 370 GDP-D-mannose-3',5'-epimerase 95.66
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 95.3
PRK06046326 alanine dehydrogenase; Validated 95.29
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.28
COG0451 314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 95.12
PRK05865 854 hypothetical protein; Provisional 95.06
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 95.05
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 95.04
COG2910211 Putative NADH-flavin reductase [General function p 94.98
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 94.94
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 94.86
COG0569225 TrkA K+ transport systems, NAD-binding component [ 94.8
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.71
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 94.67
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 94.66
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 94.61
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 94.43
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 94.42
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 94.36
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 94.35
KOG1370434 consensus S-adenosylhomocysteine hydrolase [Coenzy 94.33
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 94.28
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 94.26
PLN02260 668 probable rhamnose biosynthetic enzyme 94.26
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 94.24
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 94.24
COG1087 329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 94.18
PLN00016 378 RNA-binding protein; Provisional 94.15
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.83
PRK06407301 ornithine cyclodeaminase; Provisional 93.82
PRK06823315 ornithine cyclodeaminase; Validated 93.8
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 93.8
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 93.64
PLN02206 442 UDP-glucuronate decarboxylase 93.53
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 93.51
TIGR01777 292 yfcH conserved hypothetical protein TIGR01777. Thi 93.51
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 93.43
PF10520178 Kua-UEV1_localn: Kua-ubiquitin conjugating enzyme 93.38
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.3
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 93.27
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 93.25
PRK07201 657 short chain dehydrogenase; Provisional 93.2
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 93.12
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.07
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.0
PRK06199379 ornithine cyclodeaminase; Validated 93.0
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 92.95
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 92.89
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 92.88
PF1224278 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 92.76
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 92.72
KOG2733 423 consensus Uncharacterized membrane protein [Functi 92.7
PRK07589346 ornithine cyclodeaminase; Validated 92.62
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.61
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 92.59
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.58
PRK06718202 precorrin-2 dehydrogenase; Reviewed 92.56
PRK10669558 putative cation:proton antiport protein; Provision 92.45
PLN02778 298 3,5-epimerase/4-reductase 92.44
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.2
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.17
PLN02166 436 dTDP-glucose 4,6-dehydratase 92.17
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 92.15
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.14
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 92.11
PRK00676338 hemA glutamyl-tRNA reductase; Validated 92.09
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.07
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 92.06
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.03
PRK09496453 trkA potassium transporter peripheral membrane com 92.02
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.99
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 91.98
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.98
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.97
PLN02477410 glutamate dehydrogenase 91.96
PRK09496 453 trkA potassium transporter peripheral membrane com 91.83
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.82
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.78
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.75
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.75
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.73
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 91.71
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 91.68
COG2130340 Putative NADP-dependent oxidoreductases [General f 91.67
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 91.67
PRK12320 699 hypothetical protein; Provisional 91.6
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 91.36
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 91.32
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.28
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 91.19
PRK04148134 hypothetical protein; Provisional 91.18
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.17
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.1
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 91.1
PLN02928347 oxidoreductase family protein 91.08
PRK06719157 precorrin-2 dehydrogenase; Validated 91.06
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 91.04
PRK11150 308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 91.02
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.89
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 90.87
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 90.85
PRK08655 437 prephenate dehydrogenase; Provisional 90.83
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 90.72
PRK03562621 glutathione-regulated potassium-efflux system prot 90.51
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.49
PRK09620229 hypothetical protein; Provisional 90.47
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 90.4
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 90.4
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 90.38
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 90.33
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 90.16
PRK08328231 hypothetical protein; Provisional 90.12
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 90.1
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 89.97
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.95
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 89.92
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.88
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.77
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.73
KOG3007333 consensus Mu-crystallin [Amino acid transport and 89.68
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 89.67
COG3268 382 Uncharacterized conserved protein [Function unknow 89.67
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.54
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.51
PLN02725 306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 89.45
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 89.44
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 89.39
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 89.31
COG1090 297 Predicted nucleoside-diphosphate sugar epimerase [ 89.31
PRK13243333 glyoxylate reductase; Reviewed 89.26
TIGR02197 314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 89.14
PTZ00354334 alcohol dehydrogenase; Provisional 89.08
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 89.02
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 88.99
COG4982 866 3-oxoacyl-[acyl-carrier protein] 88.97
PRK12480330 D-lactate dehydrogenase; Provisional 88.93
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 88.91
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 88.84
KOG1430 361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 88.78
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 88.76
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 88.72
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 88.55
PLN02858 1378 fructose-bisphosphate aldolase 88.55
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.47
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 88.44
KOG1198347 consensus Zinc-binding oxidoreductase [Energy prod 88.42
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 88.37
PRK03659601 glutathione-regulated potassium-efflux system prot 88.36
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 88.36
KOG1203 411 consensus Predicted dehydrogenase [Carbohydrate tr 88.31
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 88.31
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.29
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 88.12
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 88.0
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 87.97
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 87.93
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 87.87
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 87.83
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 87.83
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 87.66
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.65
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 87.6
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 87.51
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 87.5
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 87.42
PLN02996 491 fatty acyl-CoA reductase 87.42
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 87.29
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 87.28
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.26
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 87.23
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 87.05
PRK09880343 L-idonate 5-dehydrogenase; Provisional 86.92
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 86.92
TIGR01692 288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 86.9
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 86.68
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 86.57
PLN02503 605 fatty acyl-CoA reductase 2 86.32
TIGR01381 664 E1_like_apg7 E1-like protein-activating enzyme Gsa 86.25
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 86.2
PLN02306386 hydroxypyruvate reductase 86.17
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 86.12
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 86.09
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.07
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 86.07
PRK07417279 arogenate dehydrogenase; Reviewed 86.03
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 85.96
PRK06849 389 hypothetical protein; Provisional 85.88
PRK08223287 hypothetical protein; Validated 85.84
PLN02586360 probable cinnamyl alcohol dehydrogenase 85.66
PRK07574385 formate dehydrogenase; Provisional 85.66
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 85.64
>PLN02869 fatty aldehyde decarbonylase Back     alignment and domain information
Probab=100.00  E-value=2.4e-158  Score=1277.02  Aligned_cols=612  Identities=38%  Similarity=0.695  Sum_probs=582.0

Q ss_pred             CCCCCCCCCCCCCCCceeeehhHHHHHHHhhhhhccc-CCccchhHhHHHHHHHHHHHHHHHHHhcchhhhccCCCCCCC
Q 006767            1 MDAPLAAWPWDNLGMFKYVLYGPLVGKALYSWVYEDK-RIEYWCLHILIISVLRGLIHILWNSFSNMLFLNRARQINQRG   79 (632)
Q Consensus         1 ~~~~~~~~~w~~~g~~~y~~~~p~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kI~~~~   79 (632)
                      .||+||+|||++||+|||++++|++++++|+++.+.+ +.+.|++++++++++|++++|+|++++|+.+.++|+||++|+
T Consensus         4 ~pg~lt~wpW~~lG~~Ky~~~~p~v~~~~~~~~~~~~~~~~~~~~~~l~~~~~r~l~~q~W~s~sr~~~~~~~~ri~~~~   83 (620)
T PLN02869          4 KPGILTDWPWKPLGSFKYVVLAPWVIHSIYSFVVKDEKERDLSYFLIFPFLLWRMLHNQLWISLSRYRTAKGNNRIVDKG   83 (620)
T ss_pred             CCcccccCcccccCCeeeeeehHHHHHHHHHHHhcccccccccHHHHHHHHHHHHHHHHHHHHHHhhhhhhhceeeeccC
Confidence            3899999999999999999999999999999887755 444599999999999999999999999999999999999999


Q ss_pred             CChhcccccchhhHHHHHHHHHHHHHHhhhcCCCCCCccchHHHHHHHHHHHHHHHHHHHHHHHHcCCCchhhHhhcccC
Q 006767           80 VDFKQIDNEWNWDNFILLQAAIASMGYYIFPCSESLPRWNTKGFIALQILHVAVSEPLYYVLHRHFHRNKYLFIHYHSLH  159 (632)
Q Consensus        80 ~~~~q~~~e~~~~n~~l~~~~~~~~~~~~~~~~~~~p~w~~~~~~~~~~~~~~~~d~~~Yw~HR~~H~~~~ly~~~H~~H  159 (632)
                      ++++|+|||++||||+|++.++++++...+|..+.+|.|...|+++.+++|+++.||+|||+||++|+ +++||++|++|
T Consensus        84 i~f~QvDre~~wDd~iil~~l~~~~~~~~~p~~~~~P~W~~~g~l~~~Llhv~~~Df~fYW~HRllH~-~~LYwr~HkvH  162 (620)
T PLN02869         84 IEFEQVDRERNWDDQILFNGILFYVGYMILPGASHMPLWRTDGVLITILLHMGPVEFLYYWLHRALHH-HYLYSRYHSHH  162 (620)
T ss_pred             CCceeeccccccchHHHHHHHHHHHHHHhhhhhhcCcccccchHHHHHHHHHHHHHHHHHHHHHHhhh-HHHHHHHHhhc
Confidence            99999999999999999999999999988899999999999999999999999999999999999999 99999999999


Q ss_pred             CCCCCCChhhhHHhhH-HHHHHHHHHHHHHHHHHhhccchhHHHHHHHHHHHHHHhhhcccceeeccccccccccchhhh
Q 006767          160 HSSPVPQIPTAGHATL-LEHIVLSAIVAIPILGSSIIGYGSISLIYGYILMFDFLRCLGHCNVEIIPHRWFETFPFLRYL  238 (632)
Q Consensus       160 H~~~~~~~~~~~~~hp-~E~~~~~~~~~ip~~~~~~~g~~~~~~~~~~~~~~~~~~~~~H~~~~~~p~~~~~~~p~l~~l  238 (632)
                      |++.+|+|+++. .|| .|.+.+.+++.+|+++..+++..++.++++|+++.++.++++|||++++|+++++.+|+++|+
T Consensus       163 Hss~~~~P~Ts~-~HP~~E~L~y~ll~~IPLllli~~g~~hi~t~~~yli~~~f~~~~gHSN~El~P~~~~~~~ppLkyl  241 (620)
T PLN02869        163 HSSIVTEPITSV-IHPFAEHIAYFLLFAIPLLTTIFTGTASIAAFFGYISYIDFMNNMGHCNFELIPKWLFSIFPPLKYL  241 (620)
T ss_pred             cCCCCCCchhhh-cCcHHHHHHHHHHHHHHHHHHhhcccchHHHHHHHHHHHHHHhcccccCccccccchhccCCcchhe
Confidence            999999999987 566 577877777888998877778778999999999999999999999999899998888999999


Q ss_pred             ccCcccccccccCCCCCcccCchhhhhhcCCCCCCChhhHhhhccccCCCCccCceEEeecccCcccccCccchhhhccC
Q 006767          239 LYTPTYHSLHHTEKDSNFCLFMPLFDALGNTLNSKSWEDHKKITSASGENVRVPDFVFLAHVVDVTASMHPPFVFRSLAS  318 (632)
Q Consensus       239 ~~tp~~H~lHH~~~~~Nyg~~~~~wD~lfGT~~~~~~~~~~~~~~~~~~~~~~~~~vfl~H~~~~~~~~~~~~~~~~~~~  318 (632)
                      ++||++|++||+++++|||.+|++||++|||+++++++++++...+.+   ++||||||||+||++|+||+|+|||||||
T Consensus       242 l~TPsfHdlHHs~fd~NYGlfF~~WDrLFGT~d~~s~~l~e~~~~~~~---~~pd~V~l~H~t~~~s~~h~~~~~~s~as  318 (620)
T PLN02869        242 MYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTMDKSSDTLYEKSLKRPE---EIPDVVHLTHLTTPDSIYHLRLGFASLAS  318 (620)
T ss_pred             ecCchHHhHHhccCCcCcccchHHHHhccCCCCCCchhHHHHhhcCcc---cCCCEEEEeccCCHHHhhccchHHHHhcc
Confidence            999999999999999999999999999999999999999999887643   38999999999999999999999999999


Q ss_pred             CCCCCccccCccchhHHHHHHHHHHhccceEEeeeecCCceeeEEeeccCCeecccCcchhHhHHHHHHHHHHHHHcCCc
Q 006767          319 LPYSPKLFMLPFWPLAFSAMFALWAWSKTFLISFYWLRGRLHQTWAVPRYGFQYFLPFAQTGINKQIEDAILRADRLGVK  398 (632)
Q Consensus       319 ~p~~~~~~~~~~~p~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~ip~~~~~~~~~~~~~~i~~~i~~ai~~a~~~g~~  398 (632)
                      .||+++|||+||||+++++|+++|+||++|++|+|+++|+++|+|+||||++||++|+++++||++||+||.+||++|+|
T Consensus       319 ~p~~~~~~l~~~wp~~~~~m~~~w~~~~~f~~~~~~~~~~~~~tw~vpr~~~qy~~~~~~~~in~~Ie~ail~ad~~Gvk  398 (620)
T PLN02869        319 KPYISKWYLRLMWPVTSWSMMLTWIYGRTFVLERNRFNKLNLQTWVIPKYKIQYLLKWQNESINSLIEEAILEADKRGVK  398 (620)
T ss_pred             CCccchhHHHHHHHHHHHHHHHHHHhCCceEeeeeeccceeeeEEEeccccccccCchhhhhHHHHHHHHHHHHHhcCCE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeecccccccccccCCCceEEeccCCCccceecCchhhHHHHHhhCCCCCcEEEEecCCchHHHHHHHHHHHcCCcEEEE
Q 006767          399 VLSLAALNKNESLNGGGTLFVDKHPNLKVRVVHGNTCTAAVILNELPKDVKEVFLTGATSKLGRAIALYLCRKRVRVLML  478 (632)
Q Consensus       399 v~~LGa~n~~~~l~~~g~l~~~~~p~l~v~vtdG~sltaa~~~~~i~~~gk~vlVtGasgGIG~aiA~~La~~G~~V~l~  478 (632)
                      |+|||++||++++|++|+++++|||+|+|||+||||+|||+++|+||++.|.|++||++|++|+|+|.+||++|.+  +.
T Consensus       399 v~sLg~LNk~~~LN~~G~l~v~k~p~L~vrvv~G~tLtaAvvln~ip~~~~~vfl~G~~sK~~raia~~lc~r~i~--~~  476 (620)
T PLN02869        399 VLSLGLLNQGEELNRYGELYIHRNPKLKIKVVDGSSLAVAVVLNSIPKGTTQVLFRGNLSKVAYFIASALCQRGIQ--VA  476 (620)
T ss_pred             EEechhcchhhhhcCCceEeeecCCCcceEEEeCCchHHHHHHHhcCCCCceEEEecCccHHHHHHHHHHHhcCCe--Ee
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999999  45


Q ss_pred             ecCHHHHHHHHHHcCC-CccEEEEeCCCHHHHHHHHhhhcCCccCccccccCCCCcEEEeeccCCccccCCCeEEecCCe
Q 006767          479 TLSTERFQKIQKEAPI-DCQNYLVQVTKYQAAQHSKTWIVGKWITPREQNWAPPGTHFHQFVVPPILHFRRDCTYGDLAA  557 (632)
Q Consensus       479 ~R~~e~l~~l~~~i~~-~~~~~~~Dvsd~~~~~~~di~~~g~~~~~~d~~~~~~G~vv~d~~~P~~~~~r~d~~~~~g~~  557 (632)
                      ..++|+.+++++|++. +.+.+.+.+++.    .+++|++|++++++||.++++|+.|+++++||..+.|+||+|.++++
T Consensus       477 t~~~~~~~~~~~~~~~~~~~~~l~~~~~~----~~k~w~vg~~~~~~eq~~A~~gt~f~~~~~~p~~~~R~dC~Y~~~pa  552 (620)
T PLN02869        477 TFREDEYEKLNKKLPNTECGSKLLLSKNY----SEKIWLVGDGLTEEEQKKASKGTLFIPFSQFPPKRLRKDCFYHTTPA  552 (620)
T ss_pred             ecCHHHHHHHHHhccchhhhhhEEEeecc----CceeEEecCCCCHHHHhhCCCCCeecccccCCchhhhccccccCCcc
Confidence            5689999999999987 667777777775    56789999999999999999999999999777766899999999999


Q ss_pred             eeccCccccccccccCCCchhhhHHHHHHHHHhhhccCcccccccchhcHHHHHHHHHhcCCccccc
Q 006767          558 MRLPDDVEGLGICEYTMDRGVVHACHAGGVVHLLEGWTHHEVGAIDVDKIDLVWEAALKHGFKPVSS  624 (632)
Q Consensus       558 M~~P~~~~~~~s~~~~lp~~v~~ac~a~~il~aLEg~~~~e~G~I~v~~v~~i~~~a~~hGf~~~~~  624 (632)
                      |.+|++++|++|||+|||||+|+||+|+|++||||||++|||| |||.+||++|+||+||||+|...
T Consensus       553 m~~p~~~~~~~sce~~l~r~v~~a~~~~givh~legw~~he~g-~~v~~id~~W~aal~hgf~p~~~  618 (620)
T PLN02869        553 MMSPKSFENVDSCENWLPRRAMSAWRVAGILHALEGWNVHECG-YTMFDIEKIWEASLQHGFRPLLI  618 (620)
T ss_pred             ccCChhhcccchhhccccchhhhHhhhcceeeeecCccccccc-cccccHHHHHHHHHHcCCccCCC
Confidence            9999999999999999999999999999999999999999999 99999999999999999999653



>PF12076 Wax2_C: WAX2 C-terminal domain; InterPro: IPR021940 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG0873 consensus C-4 sterol methyl oxidase [Lipid transport and metabolism] Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>KOG0872 consensus Sterol C5 desaturase [Lipid transport and metabolism] Back     alignment and domain information
>COG3000 ERG3 Sterol desaturase [Lipid metabolism] Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>KOG0874 consensus Sphingolipid hydroxylase [Lipid transport and metabolism] Back     alignment and domain information
>PF04116 FA_hydroxylase: Fatty acid hydroxylase superfamily; InterPro: IPR006694 This superfamily includes fatty acid and carotene hydroxylases and sterol desaturases Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02434 fatty acid hydroxylase Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>KOG1478 consensus 3-keto sterol reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>KOG0539 consensus Sphingolipid fatty acid hydroxylase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PLN02601 beta-carotene hydroxylase Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>PF10520 Kua-UEV1_localn: Kua-ubiquitin conjugating enzyme hybrid localisation domain; InterPro: IPR019547 This entry represents part of the transcript of the fusion of two genes, the UEV1 Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG3007 consensus Mu-crystallin [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4982 3-oxoacyl-[acyl-carrier protein] Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query632
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 99.5
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 99.5
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 99.49
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 99.46
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 99.4
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 99.4
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 99.39
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 99.35
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 99.33
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 99.31
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 99.29
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 99.28
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 99.25
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 99.22
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 99.18
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.16
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 99.15
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.12
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.11
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 99.07
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.05
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.0
4eso_A255 Putative oxidoreductase; NADP, structural genomics 98.96
4dqx_A277 Probable oxidoreductase protein; structural genomi 98.96
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 98.94
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 98.93
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 98.93
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 98.91
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 98.88
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 98.88
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 98.87
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.85
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 98.84
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 98.84
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 98.83
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 98.83
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 98.82
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 98.81
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 98.79
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 98.79
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 98.79
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 98.78
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 98.78
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 98.78
3gem_A260 Short chain dehydrogenase; structural genomics, AP 98.77
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 98.77
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 98.76
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 98.76
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 98.75
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 98.75
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 98.75
3tsc_A277 Putative oxidoreductase; structural genomics, seat 98.75
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 98.75
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 98.75
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 98.74
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 98.74
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 98.74
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 98.73
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 98.72
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 98.72
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 98.72
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 98.71
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 98.71
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 98.71
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 98.7
3imf_A257 Short chain dehydrogenase; structural genomics, in 98.7
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 98.69
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 98.69
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 98.68
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 98.68
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 98.68
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 98.68
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 98.68
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 98.67
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 98.67
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 98.67
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 98.67
1nff_A260 Putative oxidoreductase RV2002; directed evolution 98.67
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 98.67
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 98.66
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 98.66
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 98.66
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 98.66
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 98.65
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 98.65
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 98.65
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 98.65
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 98.65
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 98.64
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 98.64
3rih_A293 Short chain dehydrogenase or reductase; structural 98.64
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 98.64
3tox_A280 Short chain dehydrogenase; structural genomics, PS 98.63
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 98.63
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 98.63
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 98.63
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 98.62
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 98.62
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 98.62
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 98.62
3cxt_A291 Dehydrogenase with different specificities; rossma 98.62
3tjr_A301 Short chain dehydrogenase; structural genomics, se 98.61
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 98.61
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 98.6
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 98.6
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 98.6
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 98.6
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 98.6
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 98.6
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 98.6
1xkq_A280 Short-chain reductase family member (5D234); parra 98.59
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 98.59
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 98.59
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 98.58
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 98.58
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 98.58
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 98.57
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 98.57
1spx_A278 Short-chain reductase family member (5L265); paral 98.57
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 98.57
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 98.57
1xhl_A297 Short-chain dehydrogenase/reductase family member 98.56
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 98.56
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 98.56
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 98.55
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 98.55
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 98.55
3edm_A259 Short chain dehydrogenase; structural genomics, ox 98.55
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 98.54
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 98.54
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.54
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 98.54
3e03_A274 Short chain dehydrogenase; structural genomics, PS 98.54
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 98.54
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 98.53
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 98.53
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 98.53
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 98.53
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 98.52
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 98.52
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 98.52
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 98.52
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 98.52
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 98.52
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 98.52
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 98.51
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 98.51
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 98.51
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.5
1xq1_A266 Putative tropinone reducatse; structural genomics, 98.49
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 98.49
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 98.49
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 98.49
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 98.48
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 98.48
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 98.48
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 98.48
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 98.48
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 98.48
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 98.48
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 98.48
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.47
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 98.46
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 98.44
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 98.44
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 98.44
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 98.44
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 98.43
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 98.43
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 98.43
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 98.43
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 98.43
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 98.41
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 98.41
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 98.41
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 98.41
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 98.4
3qlj_A322 Short chain dehydrogenase; structural genomics, se 98.4
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 98.4
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 98.4
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 98.39
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 98.38
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 98.38
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 98.37
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 98.37
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 98.36
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 98.36
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 98.35
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 98.35
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 98.33
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 98.33
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 98.33
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 98.32
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 98.32
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 98.32
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 98.31
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 98.31
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 98.31
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.31
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 98.3
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 98.3
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 98.29
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 98.26
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 98.26
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 98.25
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 98.23
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 98.23
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 98.22
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 98.21
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 98.2
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 98.18
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 98.18
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 98.17
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 98.17
4e4y_A244 Short chain dehydrogenase family protein; structur 98.13
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 98.12
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 98.12
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 98.12
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 98.09
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 98.09
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 98.07
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 98.06
1xq6_A253 Unknown protein; structural genomics, protein stru 98.04
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 98.02
1ooe_A236 Dihydropteridine reductase; structural genomics, P 98.02
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 98.01
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 98.0
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 97.99
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 97.98
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 97.98
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 97.96
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 97.96
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 97.96
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 97.95
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 97.93
4ggo_A 401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 97.91
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 97.9
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 97.88
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 97.86
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 97.85
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 97.84
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 97.83
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 97.82
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 97.81
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 97.8
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.79
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 97.79
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 97.78
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 97.77
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 97.76
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.76
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.75
3slk_A795 Polyketide synthase extender module 2; rossmann fo 97.74
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 97.73
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 97.72
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.71
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 97.71
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 97.71
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 97.7
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.7
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 97.69
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 97.68
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 97.64
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 97.63
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 97.62
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 97.62
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 97.61
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 97.6
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 97.59
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 97.59
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 97.58
3lt0_A 329 Enoyl-ACP reductase; triclosan, triclosan variant, 97.57
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 97.57
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 97.55
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 97.53
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 97.51
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 97.49
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 97.46
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 97.45
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 97.45
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 97.44
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 97.42
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 97.42
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 97.4
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 97.39
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 97.37
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 97.36
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 97.36
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 97.35
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 97.35
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 97.34
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 97.34
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 97.33
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 97.32
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 97.31
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 97.3
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 97.28
4f6c_A 427 AUSA reductase domain protein; thioester reductase 97.26
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 97.22
1d7o_A 297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 97.21
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 97.2
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 97.19
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 97.17
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 97.17
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 97.13
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 97.13
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 97.12
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 97.12
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 97.11
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 97.11
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 97.09
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.08
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 97.07
2o2s_A 315 Enoyl-acyl carrier reductase; enoyl reductase, tri 97.05
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 97.03
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 97.03
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 97.03
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 97.02
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 97.02
2ptg_A 319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 97.01
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 97.01
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 97.01
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 97.0
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 96.98
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 96.98
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 96.93
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 96.91
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 96.88
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 96.87
1id1_A153 Putative potassium channel protein; RCK domain, E. 96.85
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 96.79
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 96.77
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 96.76
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 96.73
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 96.7
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 96.68
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 96.68
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 96.66
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 96.62
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 96.59
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 96.55
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 96.54
3p2o_A285 Bifunctional protein fold; structural genomics, ce 96.51
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 96.5
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 96.5
2ggs_A 273 273AA long hypothetical DTDP-4-dehydrorhamnose red 96.47
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 96.47
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.44
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 96.41
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.35
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 96.34
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 96.3
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 96.28
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 96.26
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 96.26
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 96.25
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 96.22
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 96.22
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 96.22
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 96.21
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 96.18
2rir_A300 Dipicolinate synthase, A chain; structural genomic 96.16
1eq2_A 310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 96.15
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 96.14
3l07_A285 Bifunctional protein fold; structural genomics, ID 96.14
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 96.1
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 96.1
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 96.02
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 96.0
4f6l_B 508 AUSA reductase domain protein; thioester reductase 95.98
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 95.92
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 95.92
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 95.88
3c85_A183 Putative glutathione-regulated potassium-efflux S 95.83
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.81
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 95.81
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 95.81
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 95.77
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 95.7
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 95.65
3gms_A340 Putative NADPH:quinone reductase; structural genom 95.64
4eye_A342 Probable oxidoreductase; structural genomics, niai 95.62
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 95.62
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 95.51
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 95.47
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 95.38
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 95.37
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 95.29
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 95.23
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 95.11
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 95.02
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 94.97
3fbg_A346 Putative arginate lyase; structural genomics, unkn 94.95
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 94.94
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 94.92
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 94.92
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 94.89
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 94.86
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 94.76
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 94.74
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 94.7
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 94.65
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 94.6
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 94.56
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 94.48
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 94.36
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 94.34
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 94.2
4g65_A 461 TRK system potassium uptake protein TRKA; structur 94.18
3krt_A456 Crotonyl COA reductase; structural genomics, prote 94.15
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 94.14
4b8w_A 319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 94.1
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 94.06
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 93.92
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 93.73
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 93.48
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 93.46
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 93.41
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 93.34
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 93.32
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 93.31
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 93.2
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 93.16
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 93.14
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 93.09
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 93.09
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 93.06
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 92.87
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 92.84
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 92.82
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 92.81
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 92.77
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 92.72
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 92.65
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 92.49
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 92.45
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 92.41
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 92.4
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 92.37
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 92.35
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 92.34
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 92.33
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 92.26
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 92.16
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 92.09
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 92.08
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 92.0
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 91.99
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 91.99
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 91.98
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 91.96
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 91.9
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 91.81
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 91.78
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 91.77
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 91.75
1tt5_B 434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 91.74
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 91.6
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 91.54
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 91.53
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 91.49
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 91.41
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 91.4
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 91.33
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 91.3
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 91.29
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 91.21
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 91.2
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 91.18
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 91.18
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 91.04
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 91.02
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 91.0
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 90.94
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 90.94
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 90.91
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 90.9
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 90.87
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 90.8
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 90.77
4g65_A461 TRK system potassium uptake protein TRKA; structur 90.75
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 90.74
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 90.67
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 90.66
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 90.63
3ego_A 307 Probable 2-dehydropantoate 2-reductase; structural 90.6
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 90.56
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 90.42
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 90.41
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 90.39
1lnq_A336 MTHK channels, potassium channel related protein; 90.33
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 90.32
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 90.28
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 90.26
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 90.21
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 90.16
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 90.15
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 90.13
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 90.12
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 90.11
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
Probab=99.50  E-value=9.3e-15  Score=152.30  Aligned_cols=167  Identities=17%  Similarity=0.133  Sum_probs=129.3

Q ss_pred             HHHHHHHHHcCCceeecccccccccccCCCceEEeccCCCccceecCchhhHHHHHhhCCCCCcEEEEecCCchHHHHHH
Q 006767          386 EDAILRADRLGVKVLSLAALNKNESLNGGGTLFVDKHPNLKVRVVHGNTCTAAVILNELPKDVKEVFLTGATSKLGRAIA  465 (632)
Q Consensus       386 ~~ai~~a~~~g~~v~~LGa~n~~~~l~~~g~l~~~~~p~l~v~vtdG~sltaa~~~~~i~~~gk~vlVtGasgGIG~aiA  465 (632)
                      ++++..+|+....+..+||+|+  .++.+|++.++|        |||.||..++...++...+|+++|+|+ ||+|++++
T Consensus        96 ~~v~~~lD~ls~~A~~iGAVNT--i~~~~g~l~G~N--------TD~~Gf~~~L~~~~~~l~gk~~lVlGA-GGaaraia  164 (312)
T 3t4e_A           96 QLACEYVDELTPAAKLVGAINT--IVNDDGYLRGYN--------TDGTGHIRAIKESGFDMRGKTMVLLGA-GGAATAIG  164 (312)
T ss_dssp             HHHGGGCSEECHHHHHHTCCSE--EEEETTEEEEEC--------HHHHHHHHHHHHTTCCCTTCEEEEECC-SHHHHHHH
T ss_pred             HHHHHHhhhcCHHHHHhCceeE--EEecCCEEEEeC--------CcHHHHHHHHHhcCCCcCCCEEEEECc-CHHHHHHH
Confidence            5667778999999999999999  346799999999        999999999987778889999999998 99999999


Q ss_pred             HHHHHcCC-cEEEEecC---HHHHHHHHHHcCCC--ccEEEEeCCCH----HHHHHHHh----hhcCCc---cCcc--cc
Q 006767          466 LYLCRKRV-RVLMLTLS---TERFQKIQKEAPID--CQNYLVQVTKY----QAAQHSKT----WIVGKW---ITPR--EQ  526 (632)
Q Consensus       466 ~~La~~G~-~V~l~~R~---~e~l~~l~~~i~~~--~~~~~~Dvsd~----~~~~~~di----~~~g~~---~~~~--d~  526 (632)
                      ..|++.|+ +|.+++|+   .++++++++++...  ......+..+.    +.++++|+    +.+|..   -.+.  +.
T Consensus       165 ~~L~~~G~~~v~v~nRt~~~~~~a~~la~~~~~~~~~~v~~~~~~~l~~~~~~l~~~DiIINaTp~Gm~~~~~~~~~~~~  244 (312)
T 3t4e_A          165 AQAAIEGIKEIKLFNRKDDFFEKAVAFAKRVNENTDCVVTVTDLADQHAFTEALASADILTNGTKVGMKPLENESLIGDV  244 (312)
T ss_dssp             HHHHHTTCSEEEEEECSSTHHHHHHHHHHHHHHHSSCEEEEEETTCHHHHHHHHHHCSEEEECSSTTSTTSTTCCSCCCG
T ss_pred             HHHHHcCCCEEEEEECCCchHHHHHHHHHHhhhccCcceEEechHhhhhhHhhccCceEEEECCcCCCCCCCCCcccCCH
Confidence            99999998 89999999   89999998876432  22334566664    23445554    333431   1111  33


Q ss_pred             ccCCCCcEEEeec-cCCc----cccC-CCeEEecCCeeeccCc
Q 006767          527 NWAPPGTHFHQFV-VPPI----LHFR-RDCTYGDLAAMRLPDD  563 (632)
Q Consensus       527 ~~~~~G~vv~d~~-~P~~----~~~r-~d~~~~~g~~M~~P~~  563 (632)
                      ..++++.+++|++ .|.+    .++| .+|.+++|..|.+-..
T Consensus       245 ~~l~~~~~v~D~vY~P~~T~ll~~A~~~G~~~~~Gl~MLv~Qa  287 (312)
T 3t4e_A          245 SLLRPELLVTECVYNPHMTKLLQQAQQAGCKTIDGYGMLLWQG  287 (312)
T ss_dssp             GGSCTTCEEEECCCSSSSCHHHHHHHHTTCEEECHHHHHHHHH
T ss_pred             HHcCCCCEEEEeccCCCCCHHHHHHHHCCCeEECcHHHHHHHH
Confidence            4578899999999 8876    3344 8999999999976543



>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 632
d1bdba_276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 1e-05
d1k2wa_256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 4e-05
d1q7ba_243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 4e-05
d2a4ka1241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 7e-05
d1hxha_253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 8e-05
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 9e-05
d1zema1260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 3e-04
d1hdca_254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 4e-04
d1nffa_244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 6e-04
d2ag5a1245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 7e-04
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 9e-04
d1h5qa_260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 0.001
d1jaya_212 c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase 0.001
d2rhca1257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 0.001
d2o23a1248 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr 0.001
d2fr1a1259 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI 0.001
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 0.001
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 0.002
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 0.002
d1fmca_255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 0.002
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 0.002
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 0.002
d1edoa_244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 0.003
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 0.003
d1w6ua_294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 0.003
d1vl8a_251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 0.003
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase
species: Pseudomonas sp., lb400 [TaxId: 306]
 Score = 45.4 bits (107), Expect = 1e-05
 Identities = 16/97 (16%), Positives = 36/97 (37%)

Query: 449 KEVFLTGATSKLGRAIALYLCRKRVRVLMLTLSTERFQKIQKEAPIDCQNYLVQVTKYQA 508
           + V +TG  S LGRA+      +  +V +L  S ER  +++ +   +    +  V   + 
Sbjct: 6   EAVLITGGASGLGRALVDRFVAEGAKVAVLDKSAERLAELETDHGDNVLGIVGDVRSLED 65

Query: 509 AQHSKTWIVGKWITPREQNWAPPGTHFHQFVVPPILH 545
            + + +  V ++              +   +V     
Sbjct: 66  QKQAASRCVARFGKIDTLIPNAGIWDYSTALVDLPEE 102


>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 212 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Length = 259 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query632
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.32
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.28
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.26
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.25
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.21
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.2
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.2
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.2
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.19
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.19
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.19
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.18
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.17
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.16
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.16
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.16
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.15
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.15
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.15
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.13
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.11
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 99.11
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.09
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.09
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.07
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.07
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.07
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.07
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.04
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.02
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.01
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.0
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 98.98
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.98
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 98.96
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 98.96
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 98.92
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 98.92
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 98.92
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 98.92
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 98.9
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 98.89
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 98.87
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 98.86
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 98.83
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 98.82
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 98.8
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 98.78
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 98.76
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 98.75
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 98.74
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 98.74
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 98.73
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 98.7
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 98.58
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 98.57
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 98.56
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 98.55
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 98.5
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 98.38
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 98.37
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 98.37
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 98.36
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 98.35
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 98.34
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 98.34
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 98.16
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 98.03
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 97.89
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 97.85
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 97.83
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.83
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 97.79
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.69
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 97.4
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 97.37
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.36
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 97.29
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 97.22
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 97.14
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 97.05
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 97.05
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 97.02
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 96.96
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 96.94
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 96.9
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.82
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 96.81
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.77
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 96.76
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.74
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 96.74
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.6
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 96.53
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.44
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 96.41
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 96.38
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 96.35
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 96.25
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 96.2
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 96.19
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 96.18
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 96.17
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 96.05
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 96.01
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 95.99
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.85
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 95.79
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.55
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 95.54
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 95.53
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.51
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 95.48
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.41
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 95.37
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 95.21
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 95.2
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 95.18
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.1
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 95.08
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 94.99
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 94.85
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 94.8
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 94.77
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 94.28
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.15
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 94.13
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 94.09
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 94.06
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 93.96
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 93.81
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 93.8
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 93.8
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 93.75
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 93.73
d1id1a_153 Rck domain from putative potassium channel Kch {Es 93.71
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 93.64
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 93.44
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 93.43
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 93.34
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 93.27
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 93.26
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 93.16
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 93.02
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 92.94
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 92.88
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 92.83
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 92.76
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 92.71
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 92.65
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 92.62
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 92.6
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 92.59
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 92.54
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 92.11
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 92.06
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 92.05
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 92.03
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 91.99
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 91.87
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 91.8
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 91.64
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 91.5
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 91.49
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 91.49
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 91.41
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 91.08
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 90.57
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 90.41
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 90.18
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 90.13
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 90.06
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 89.88
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 89.87
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 89.55
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 89.46
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 89.38
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 89.37
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 89.33
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 89.31
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 89.28
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 89.2
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 89.17
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 89.04
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 88.91
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 88.81
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 88.76
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 88.46
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 88.3
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 88.28
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 88.26
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 88.11
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 87.87
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 87.7
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 87.42
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 87.42
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 87.26
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 87.14
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 87.12
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 87.08
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 87.01
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 86.99
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 86.76
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 86.73
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 86.64
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 86.47
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 86.46
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 86.43
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 86.24
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 86.1
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 85.93
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 85.82
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 85.68
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 84.79
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 84.59
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 83.85
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 83.72
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 83.47
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 83.34
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 83.16
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 83.0
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 82.8
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 82.52
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 81.94
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 81.94
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 81.69
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 81.48
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 81.46
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 80.71
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 80.67
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 80.6
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 80.58
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 80.06
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Sorbitol dehydrogenase
species: Rhodobacter sphaeroides [TaxId: 1063]
Probab=99.32  E-value=1.4e-12  Score=129.96  Aligned_cols=68  Identities=22%  Similarity=0.248  Sum_probs=64.0

Q ss_pred             CCCCcEEEEecCCchHHHHHHHHHHHcCCcEEEEecCHHHHHHHHHHcCCCccEEEEeCCCHHHHHHH
Q 006767          445 PKDVKEVFLTGATSKLGRAIALYLCRKRVRVLMLTLSTERFQKIQKEAPIDCQNYLVQVTKYQAAQHS  512 (632)
Q Consensus       445 ~~~gk~vlVtGasgGIG~aiA~~La~~G~~V~l~~R~~e~l~~l~~~i~~~~~~~~~Dvsd~~~~~~~  512 (632)
                      .++||+++||||++|||+++|+.|+++|++|++++|++++++++.++++.++..+.+|++|.++++++
T Consensus         2 ~L~gK~alVTGas~GIG~aia~~la~~Ga~V~~~~r~~~~l~~~~~~~~~~~~~~~~Dvt~~~~v~~~   69 (256)
T d1k2wa_           2 RLDGKTALITGSARGIGRAFAEAYVREGARVAIADINLEAARATAAEIGPAACAIALDVTDQASIDRC   69 (256)
T ss_dssp             TTTTEEEEEETCSSHHHHHHHHHHHHTTEEEEEEESCHHHHHHHHHHHCTTEEEEECCTTCHHHHHHH
T ss_pred             CCCCCEEEEeCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHhCCceEEEEeeCCCHHHHHHH
Confidence            46899999999999999999999999999999999999999999999988888889999999999765



>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure