Citrus Sinensis ID: 006814

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630

MGQQPREDIANTVRILVATDCHLGYMEKDEIRRHDSFEAFEEICSIAEQKEVDFVLLGGDLFHENKPSRSTLVKAIEILRRHCLNDRPVQFQVVSDQAVNFQNKFGHVNYEDPHFNVGLPVFSIHGNHDDPAGVDNLSAVDILSACNLVNYFGKMVLGGSGVGEITVYPILIRKGSTAVALYGLGNIRDERLNRMFQTPHAVQWMRPEAQEECQVSDWFNILVLHQNRVKTNPKNAINEHFLPRFLDFVVWGHEHECLIDPQEVPGMGFHLTQPGSSVATSLIEGESKPKHVLLLEIKENQYRPTKIPLTSVRPFEYTEIILKDEADIDPDDQNSILEHLDKVVRNLIERSSKKTVNRSELKLPLVRIKVDYSGFMTINPQRFGQKYVGKVANPQDILIFSKSSKKSKAEAKIDDFERLRPEELNQQNIEALVAENNLKMEIIPVNDLDVALHNFVNKDDRLAFYSCVQYNLQETRHKIAKDSDTAKFEEEDIILKVGESLEERLKERSNHSKDAPQSTSNAASFEDIRSKTAAGVGTAISFSDDEDTTQISDTKSATRGRKWSSAASRSSRGALESDKSKTSTRGRGRGRGRGRGRGANNLKQTTLDASLGFRQSQSISCCKSSSPKSC

ccccccccccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHHHHHccccccEEEEEccccccccccccccccccccccccccEEEECcccccccccccccHHHHHHHcccccccccccccccccccEEEEEEEEEEccEEEEEEccccccHHHHHHHcccccHHHccccccHHcccccccEEEEEEEEcccccccccccccccccccccEEEEcccccccccccccccccEEEECcccccccccccccccccEEEEEEEEcccccEEECccccccccEEEEEEECcccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

********IANTVRILVATDCHLGYMEKDEIRRHDSFEAFEEICSIAEQKEVDFVLLGGDLFHENKPSRSTLVKAIEILRRHCLNDRPVQFQVVSDQAVNFQNKFGHVNYEDPHFNVGLPVFSIHGNHDDPAGVDNLSAVDILSACNLVNYFGKMVLGGSGVGEITVYPILIRKGSTAVALYGLGNIRDERLNRMFQTPHAVQWMRPEAQEECQVSDWFNILVLHQNRVKTNPKNAINEHFLPRFLDFVVWGHEHECLIDPQEVPGMGFHLTQPGSSVATSLIEGESKPKHVLLLEIKENQYRPTKIPLTSVRPFEYTEIILKDEADIDPDDQNSILEHLDKVVRNLIERSSKKTVNRSELKLPLVRIKVDYSGFMTINPQRFGQKYVGKVANPQDILIFSK***********************QQNIEALVAENNLKMEIIPVNDLDVALHNFVNKDDRLAFYSCVQYNLQETRHKI*************IIL***************************************************************************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Double-strand break repair protein MRE11	Involved in DNA double-strand break repair (DSBR). Possesses single-strand endonuclease activity and double-strand-specific 3'-5' exonuclease activity. Also involved in meiotic DSB processing.	confident	Q9XGM2
Double-strand break repair protein MRE11A	Component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis. The complex possesses single-strand endonuclease activity and double-strand-specific 3'-5' exonuclease activity, which are provided by MRE11A. RAD50 may be required to bind DNA ends and hold them in close proximity. This could facilitate searches for short or long regions of sequence homology in the recombining DNA templates, and may also stimulate the activity of DNA ligases and/or restrict the nuclease activity of MRE11A to prevent nucleolytic degradation past a given point. The complex may also be required for DNA damage signaling via activation of the ATM kinase. In telomeres the MRN complex may modulate t-loop formation.	probable	Q9JIM0
Double-strand break repair protein MRE11A	Component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis. The complex possesses single-strand endonuclease activity and double-strand-specific 3'-5' exonuclease activity, which are provided by MRE11A. RAD50 may be required to bind DNA ends and hold them in close proximity. This could facilitate searches for short or long regions of sequence homology in the recombining DNA templates, and may also stimulate the activity of DNA ligases and/or restrict the nuclease activity of MRE11A to prevent nucleolytic degradation past a given point. The complex may also be required for DNA damage signaling via activation of the ATM kinase. In telomeres the MRN complex may modulate t-loop formation.	probable	Q61216

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T1I, chain A
Confidence level:very confident
Coverage over the Query: 7-97,115-402
View the alignment between query and template
View the model in PyMOL