Citrus Sinensis ID: 006830

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------63

MDSGEFDYQRRTGSVKAAGNMYGGSPSVKKSHLDIPESSSSRARELHMARRDISRYKESRKAAESVKAQAESELSTARKTVKDLACRIEKTNHQAIPSMRYVERLEKSSGIEENVLAERSRESHRYAEVMRELESVKQELSKLKLDMASVLEEKSRAEKEIEASSLKMRSNSSSVEGLRKEIEEVNEEQVLVELARIEALKEYGEIEAEREKEANEFSASMEVAKEKLKDLTEEIDHCKELENKLAVTLYDVNFLHNELKSVKDKDKLVQGNDSLKGTHSIYQSGEELEGSPLLPSKSVKEELEAAKKELAAIKEEGFRFMASMDVIRNELRHVREETARLKKGEEKTELTVQNLNSKLLRAKAKLEAVSAAEEKANGIAGNLAFTLEQLKTEAEAAKKEKELVTEETAKIKEEIQKTEAEIYSAEEKIETSMQELNAVKSSEALAFDNLKSLIEKTMQARASASQNSSSITISNFEYEYLRGRAVGAEELADKKVAAAQAWIEALKASEKEILMKMEMAHREIRHTRVEEEKEVFKSERTRSTKRRVERELRNWRQNSERTAEPESLQPGLARKSRRGSDNLTPSRRPKSRKSASPATGMTRTTSFTIKKKTKVIPNFTKLFSGKKID

cccccccccccccHHHHHHHHccccccccccccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcHHHHHHccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccccccccHHHHcccccccccccccccccccccccccccccccHHHHHHcccccHHHHHHccccc

*********RRTGSVKAAGN*****************************************************************CR******************************************************************************************************VLVELARIEALKEY*****************************EEIDHCKELENKLAVTLYDVNFLHNELK********************************************************GFRFMASMDVIRN*************************************************IAGNLAFTL***********************************************************************************ITISNFEYEYLRGRAVGAEELADKKVAAAQAWIEALKAS***IL***************************************************************************************************KVIPNFTKLFSGK***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDSGEFDYQRRTGSVKAAGNMYGGSPSVKKSHLDIPESSSSRARELHMARRDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIEKTNHQAIPSMRYVERLEKSSGIEENVLAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRIEALKEYGEIEAEREKExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLAVTLYDVNFLHNELKSVKDKDKLVQGNDSLKGTHSIYQSGEELEGSPLLPxxxxxxxxxxxxxxxxxxxxxGFRFMASMDVIRNELRHVREETARLKKGxxxxxxxxxxxxxxxxxxxxxxxxxxxxEEKANGIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLNAVKSSEALAFDNLKSLIEKTMQARASASQNSSSITISNFEYEYLRGRAVGAEELADKKVAAAQAWIEALKASEKEILMKMEMAHREIRHTRVEEEKEVFKxxxxxxxxxxxxxxxxxxxxxSERTAEPESLQPGLARKSRRGSDNLTPSRRPKSRKSASPATGMTRTTSFTIKKKTKVIPNFTKLFSGKKID

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein PLASTID MOVEMENT IMPAIRED 2	Required for the chloroplast avoidance response under high intensity blue light. This avoidance response consists in the relocation of chloroplasts on the anticlinal side of exposed cells. Acts in association with WEB1 to maintain the velocity of chloroplast photorelocation movement via cp-actin filaments regulation.	probable	Q9C9N6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 42-88
View the alignment between query and template
View the model in PyMOL

Template: 2DFS, chain A
Confidence level:confident
Coverage over the Query: 305-368
View the alignment between query and template
View the model in PyMOL

Template: 3NA7, chain A
Confidence level:probable
Coverage over the Query: 316-450
View the alignment between query and template
View the model in PyMOL

Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 211-257
View the alignment between query and template
View the model in PyMOL

Template: 2XS1, chain A
Confidence level:probable
Coverage over the Query: 50-245
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
3vkg, chain A		confident	Alignment \| Template Structure