BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 006855
         (628 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1UMY|A Chain A, Bhmt From Rat Liver
 pdb|1UMY|B Chain B, Bhmt From Rat Liver
 pdb|1UMY|C Chain C, Bhmt From Rat Liver
 pdb|1UMY|D Chain D, Bhmt From Rat Liver
          Length = 407

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 299 VTEEGIKSVINFLKEKIPGLKVKVMNIDITAEVTDDADSL 338
            +E+ +++  N++ EKI G KV     DI  +V D+ D+L
Sbjct: 78  ASEDKLENRGNYVAEKISGQKVNEAACDIARQVADEGDAL 117


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.133    0.386 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,514,913
Number of Sequences: 62578
Number of extensions: 638743
Number of successful extensions: 1228
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1219
Number of HSP's gapped (non-prelim): 9
length of query: 628
length of database: 14,973,337
effective HSP length: 105
effective length of query: 523
effective length of database: 8,402,647
effective search space: 4394584381
effective search space used: 4394584381
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 54 (25.4 bits)