BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 006875
(628 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2GTQ|A Chain A, Crystal Structure Of Aminopeptidase N From Human Pathogen
Neisseria Meningitidis
Length = 867
Score = 29.6 bits (65), Expect = 5.1, Method: Compositional matrix adjust.
Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 6/53 (11%)
Query: 26 DRKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPAKLTG 78
DR P +A+ +V+A LC+ LEP + +V + ++R A+ G +K G
Sbjct: 813 DRFNPQVAARLVQAFN------LCNKLEPHRKNLVKQALQRIRAQEGLSKDVG 859
>pdb|3JSK|A Chain A, Thiazole Synthase From Neurospora Crassa
pdb|3JSK|B Chain B, Thiazole Synthase From Neurospora Crassa
pdb|3JSK|C Chain C, Thiazole Synthase From Neurospora Crassa
pdb|3JSK|D Chain D, Thiazole Synthase From Neurospora Crassa
pdb|3JSK|E Chain E, Thiazole Synthase From Neurospora Crassa
pdb|3JSK|F Chain F, Thiazole Synthase From Neurospora Crassa
pdb|3JSK|G Chain G, Thiazole Synthase From Neurospora Crassa
pdb|3JSK|H Chain H, Thiazole Synthase From Neurospora Crassa
pdb|3JSK|I Chain I, Thiazole Synthase From Neurospora Crassa
pdb|3JSK|J Chain J, Thiazole Synthase From Neurospora Crassa
pdb|3JSK|K Chain K, Thiazole Synthase From Neurospora Crassa
pdb|3JSK|L Chain L, Thiazole Synthase From Neurospora Crassa
pdb|3JSK|M Chain M, Thiazole Synthase From Neurospora Crassa
pdb|3JSK|N Chain N, Thiazole Synthase From Neurospora Crassa
pdb|3JSK|O Chain O, Thiazole Synthase From Neurospora Crassa
pdb|3JSK|P Chain P, Thiazole Synthase From Neurospora Crassa
Length = 344
Score = 29.3 bits (64), Expect = 7.8, Method: Compositional matrix adjust.
Identities = 14/45 (31%), Positives = 24/45 (53%)
Query: 1 MQTRYMERSNSKRGLDSSSAEEGQPDRKRPALASVIVEALKVDSL 45
+ + MER N RGLD SAE+ + R + +IV +++ +
Sbjct: 262 VSMKQMERLNGMRGLDMQSAEDAIVNNTREIVPGLIVGGMELSEI 306
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.315 0.134 0.392
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 20,041,325
Number of Sequences: 62578
Number of extensions: 894363
Number of successful extensions: 2004
Number of sequences better than 100.0: 11
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 10
Number of HSP's that attempted gapping in prelim test: 1998
Number of HSP's gapped (non-prelim): 13
length of query: 628
length of database: 14,973,337
effective HSP length: 105
effective length of query: 523
effective length of database: 8,402,647
effective search space: 4394584381
effective search space used: 4394584381
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (25.4 bits)