BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 006894
         (627 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2J5B|A Chain A, Structure Of The Tyrosyl Trna Synthetase From Acanthamoeba
           Polyphaga Mimivirus Complexed With Tyrosynol
 pdb|2J5B|B Chain B, Structure Of The Tyrosyl Trna Synthetase From Acanthamoeba
           Polyphaga Mimivirus Complexed With Tyrosynol
          Length = 348

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query: 484 SLCQMGI---KVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTEQARAPKGTIFIPY 540
            +CQ+GI   KV  +  +      L+IP+   H++++S S    K  ++  P+G IF+  
Sbjct: 188 DICQLGIDQRKVNMLAIEYANDRGLKIPISLSHHMLMSLSGPKKKMSKS-DPQGAIFMDD 246

Query: 541 TQ 542
           T+
Sbjct: 247 TE 248


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.139    0.445 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 17,738,135
Number of Sequences: 62578
Number of extensions: 688511
Number of successful extensions: 1860
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1859
Number of HSP's gapped (non-prelim): 2
length of query: 627
length of database: 14,973,337
effective HSP length: 105
effective length of query: 522
effective length of database: 8,402,647
effective search space: 4386181734
effective search space used: 4386181734
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 54 (25.4 bits)