BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 006894
(627 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2J5B|A Chain A, Structure Of The Tyrosyl Trna Synthetase From Acanthamoeba
Polyphaga Mimivirus Complexed With Tyrosynol
pdb|2J5B|B Chain B, Structure Of The Tyrosyl Trna Synthetase From Acanthamoeba
Polyphaga Mimivirus Complexed With Tyrosynol
Length = 348
Score = 30.8 bits (68), Expect = 2.5, Method: Compositional matrix adjust.
Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 4/62 (6%)
Query: 484 SLCQMGI---KVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTEQARAPKGTIFIPY 540
+CQ+GI KV + + L+IP+ H++++S S K ++ P+G IF+
Sbjct: 188 DICQLGIDQRKVNMLAIEYANDRGLKIPISLSHHMLMSLSGPKKKMSKS-DPQGAIFMDD 246
Query: 541 TQ 542
T+
Sbjct: 247 TE 248
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.139 0.445
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 17,738,135
Number of Sequences: 62578
Number of extensions: 688511
Number of successful extensions: 1860
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1859
Number of HSP's gapped (non-prelim): 2
length of query: 627
length of database: 14,973,337
effective HSP length: 105
effective length of query: 522
effective length of database: 8,402,647
effective search space: 4386181734
effective search space used: 4386181734
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 54 (25.4 bits)