Citrus Sinensis ID: 006901

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620------

MASNLKVDQLRAKLAQRGLSTAGTKAILVQRLEEAVEEENKKSVGSKKRGRECDETDSNGSQKVKSIESFGQMGVKQLREQADLRGLSKAGTKKELLERLCNHAEQSDSKDTLLQEEVNECKDEKIVKATKKGAAVLDPWLPEHIKISYHVFQKDNDIYDAMLNQTNVGDNNNKFYVIQLLESDGGGEYMVYNRWGRVGMKGQDKIFGPYNLQDTAINEFEQKFFAKTKNHWSNRRQFTSYPKCYTWLEMDYSANQKEESVVHEKPNSTINIQPRNTKLEPCVAKFISLICNISMMKQLMMEIGYNANKLPLGKLSKSTILKGYDVLKRIADVIHPPDRRKLEELSGEFYTVIPHDFGFKKMRDFVIDTPQKLKLKLEMVEALGEIEVATKLLEDDTEIQADPLYSHYQRLHCQLTPLEVDSLEFSLIANYLLNTHAKTHSAYSVDIVQIFRVEREGETERFRKFSNSKNRMLLWHGSRLTNWTGILSQGLRIAPPEAPATGYMFGKGVYFADMFSKSANYCYASPSATAGVLLLCEVALGDMSELLYANYDADKLPDGKLSTKGVGQTAPDPLEAETLEDGVIVPLGKPKEQLNSKGHLLYNEYIVYSVDQIRMRYVVQVNFKYK

ccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHccccccccccHHHHHHHHHcHHHHHHHHHHcccccccccccccccccEEEEEEcccEEEEEEEEEccccccccEEEEEEEECcccccEEEEEEECccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccEEEEcccccccccHHHccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHccccccccccHHHHHHccccEEEECccccHHHHHHHHHHHHccccccccccEEEEEEEEEEccHHHHHHHHcccccccEEEEcccccccHHHHHHHccccccccccccccccCEEEEEccccccccccccccccccEEEEEEEEEEcccccccccccccccccccccccccccccccccccccEEccccEEEccccccccccccccccccEEEEEEcccEEEEEEEEEEEEEc

***NLKV*QLRAKLAQRGLSTAGTKAILVQRL*******************************************************************************TLLQEEVNECKDEKIVKATKKGAAVLDPWLPEHIKISYHVFQKDNDIYDAMLNQTNVGDNNNKFYVIQLLESDGGGEYMVYNRWGRVGMKGQDKIFGPYNLQDTAINEFEQKFFAKTKNHWSNRRQFTSYPKCYTWLEMDYSANQKEES***************NTKLEPCVAKFISLICNISMMKQLMMEIGYNANKLPLGKLSKSTILKGYDVLKRIADVIHPPDRRKLEELSGEFYTVIPHDFGFKKMRDFVIDTPQKLKLKLEMVEALGEIEVATKLLEDDTEIQADPLYSHYQRLHCQLTPLEVDSLEFSLIANYLLNTHAKTHSAYSVDIVQIFRVEREGETERFRKFSNSKNRMLLWHGSRLTNWTGILSQGLRIAPPEAPATGYMFGKGVYFADMFSKSANYCYASPSATAGVLLLCEVALGDMSELLYANYDADKLPDGKLSTKGVGQTAPDPLEAETLEDGVIVPLGKPKEQLNSKGHLLYNEYIVYSVDQIRMRYVVQVNFKYK

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MASNLKVDQLRAKLAQRGLSTAGTKAILxxxxxxxxxxxxxxxxxxxxxGRECDETDSNGSQKVKSIESFGQMGVKQLREQADLRGLSKAGTKKELLERLCNHAEQSDSKDTLLQEEVNECKDEKIVKATKKGAAVLDPWLPEHIKISYHVFQKDNDIYDAMLNQTNVGDNNNKFYVIQLLESDGGGEYMVYNRWGRVGMKGQDKIFGPYNLQDTAINEFEQKFFAKTKNHWSNRRQFTSYPKCYTWLEMDYSANQKEESVVHEKPNSTINIQPRNTKLEPCVAKFISLICNISMMKQLMMEIGYNANKLPLGKLSKSTILKGYDVLKRIADVIHPPDRRKLEELSGEFYTVIPHDFGFKKMRDFVIDTPQKLKLKLEMVEALGEIEVATKLLEDDTEIQADPLYSHYQRLHCQLTPLEVDSLEFSLIANYLLNTHAKTHSAYSVDIVQIFRVEREGETERFRKFSNSKNRMLLWHGSRLTNWTGILSQGLRIAPPEAPATGYMFGKGVYFADMFSKSANYCYASPSATAGVLLLCEVALGDMSELLYANYDADKLPDGKLSTKGVGQTAPDPLEAETLEDGVIVPLGKPKEQLNSKGHLLYNEYIVYSVDQIRMRYVVQVNFKYK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Poly [ADP-ribose] polymerase 2-A	Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks.	probable	Q5Z8Q9
Poly [ADP-ribose] polymerase 2	Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks.	probable	Q11207
Poly [ADP-ribose] polymerase 2	Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks.	probable	O50017

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.4.-.-	Glycosyltransferases.	probable
2.4.2.-	Pentosyltransferases.	probable
2.4.2.30	NAD(+) ADP-ribosyltransferase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DQY, chain C
Confidence level:very confident
Coverage over the Query: 135-251,276-613
View the alignment between query and template
View the model in PyMOL

Template: 1JJR, chain A
Confidence level:confident
Coverage over the Query: 39-40,52-105
View the alignment between query and template
View the model in PyMOL