BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 006945
         (624 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4GNS|B Chain B, Crystal Structure Of The Chs5-Chs6 Exomer Cargo Adaptor
           Complex
          Length = 754

 Score = 28.9 bits (63), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 28/61 (45%), Gaps = 7/61 (11%)

Query: 26  TGFSGTTKQWEETFGSRYPKAGAMYRG--TAPSPLTTIPFSSDIVSKEVVSSKECQKIIN 83
           T  + T K WEETF S   +A          P  L   PF    V K+ +SS  C+KII 
Sbjct: 167 TDLTMTEKMWEETFASSVIRAIITNTNPELKPPGLVECPFY---VGKDTISS--CKKIIE 221

Query: 84  I 84
           +
Sbjct: 222 L 222


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.130    0.368 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,240,367
Number of Sequences: 62578
Number of extensions: 561651
Number of successful extensions: 1001
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1001
Number of HSP's gapped (non-prelim): 1
length of query: 624
length of database: 14,973,337
effective HSP length: 105
effective length of query: 519
effective length of database: 8,402,647
effective search space: 4360973793
effective search space used: 4360973793
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 54 (25.4 bits)