Citrus Sinensis ID: 006973

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620---

MDKTVSPDAISTILSNPSPDSSSDIPEIVVQVLDLKLTGNRYMFNASDGKKRLKAILPSNLSSEVISGNIQNKGLIRLLDYALNEIPTKSEKYLIVTKCEVVSPALEMEIKIEVKSDESGIIFKPKQEDEVKKDGPGIVLKPKQEMVAKSAAQILRDQNGNMAPAARLAMTRRVHPLVSLNPYQGNWTIKVRVTSKGNMRTYKNARGEGCVFNVELTDEDGTQIQATMFNEAARKFYDRFQLGKVYYISRGTLRVANKQFKTVQNDYEMNLNENSEVEEAVNETAFIPQTKFNFVPIDELGRYVNGTELVDIIGVVQNVSPTMSIRRKSNNEMVPKRDITVADETKRTVTVSLWNELATNVGQELLDNADKSPIVAIKSLKVGDFQGISLSTLGRSTVLVSPDLPEAKKLKSWYESEGKGTSMASIGSGLGSLAKNGARSMYSDRVSLTHITSNPSLGDEKPVFFSIKAYISLIKPDQAMWYRACKTCNKKVTDALGSGYWCEGCQKNDEECSLRYIMVARVCDGSGEAWISIFNEEAERIIGCSADELNELKSQLGDDNSYQMKLKEVTWVPHLLRVSVAQQEYNNEKRQRVTVRAVAPVDFAAESKFLLEEISKKVSHQNA

ccccccHHHHHHHHccccccccccccccEEEEEEEECcccCEEEEECccccccccccccccccccccccccccEEEEEcEEEEEEEcccccEEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccHHccccHHHHccccccccccHHcccccccccccEEcccccccCEEEEEEEEEccccccccccccEEEEEEEEEcccccEEEEEEEcHHHHHHccccccccEEEEEEEEEEEcccccEEcccccEEECcccccEEEcccccccccccccccccccccccccccccEEEEEEEEEEccccEEEEEcccccEEEEEEEEEEcccccEEEEEEcHHHHHHHHHHHHcccccccEEEEEccEEEECcccEEcccccCEEEEccccHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEEccccccccccCEEEEEEEEEEEEccccEEEEccccccccEEEccccCEEcccccccccccccEEEEEEEEEEccccEEEEEEHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHcccEEEEEEEEEEEEEccCEEEEEEEEEEECccHHHHHHHHHHHHHHHHHcccc

********AISTILSNPSPDSSSDIPEIVVQVLDLKLTGNRYMFNASDGKKRLKAILPSNLSSEVISGNIQNKGLIRLLDYALNEIPTKSEKYLIVTKCEVVSPALEM**************************************************************TRRVHPLVSLNPYQGNWTIKVRVTSKGNMRTYKNARGEGCVFNVELTDEDGTQIQATMFNEAARKFYDRFQLGKVYYISRGTLRVANKQFKTVQNDYEMNLNENSEVEEAVNETAFIPQTKFNFVPIDELGRYVNGTELVDIIGVVQNVSPTMSIRRKSNNEMVPKRDITVADETKRTVTVSLWNELATNVGQELLDNADKSPIVAIKSLKVGDFQGISLSTLGRSTVLVSPDLPEAKKLKSWYESEGKGTS************KNGARSMYSDRVSLTHITSNPSLGDEKPVFFSIKAYISLIKPDQAMWYRACKTCNKKVTDALGSGYWCEGCQKNDEECSLRYIMVARVCDGSGEAWISIFNEEAERIIGCSADELNELKSQLGDDNSYQMKLKEVTWVPHLLRVSVAQQEYNNEKRQRVTVRAVAPVDFAAESKFLLEE***K******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDKTVSPDAISTILSNPSPDSSSDIPEIVVQVLDLKLTGNRYMFNASDGKKRLKAILPSNLSSEVISGNIQNKGLIRLLDYALNEIPTKSEKYLIVTKCEVVSPALEMEIKIEVKSDESGIIFKPKQEDEVKKDGPGIVLKPKQEMVAKSAAQILRDQNGNMAPAARLAMTRRVHPLVSLNPYQGNWTIKVRVTSKGNMRTYKNARGEGCVFNVELTDEDGTQIQATMFNEAARKFYDRFQLGKVYYISRGTLRVANKQFKTVQNDYEMNLNENSEVEEAVNETAFIPQTKFNFVPIDELGRYVNGTELVDIIGVVQNVSPTMSIRRKSNNEMVPKRDITVADETKRTVTVSLWNELATNVGQELLDNADKSPIVAIKSLKVGDFQGISLSTLGRSTVLVSPDLPEAKKLKSWYESEGKGTSMASIGSGLGSLAKNGARSMYSDRVSLTHITSNPSLGDEKPVFFSIKAYISLIKPDQAMWYRACKTCNKKVTDALGSGYWCEGCQKNDEECSLRYIMVARVCDGSGEAWISIFxxxxxxxxxxxxxxxxxxxxxLGDDNSYQMKLKEVTWVPHLLRVSVAQQEYNNEKRQRVTVRAVAPVDFAAESKFLLEEISKKVSHQNA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Replication protein A 70 kDa DNA-binding subunit	Participates in a very early step in DNA replication. RP-A is a single-stranded DNA-binding protein.	probable	Q24492
Replication factor A protein 1	Binds to single-stranded sequences.	probable	Q92372
Replication factor A protein 1	Binds to single-stranded sequences participating in DNA replication in addition to those mediating transcriptional repression (URS1) and activation (CAR1). Stimulates the activity of a cognate strand exchange protein (SEP1). It cooperates with T-AG and DNA topoisomerase I to unwind template DNA containing the simian virus 40 origin of DNA replication.	probable	P22336

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JMC, chain A
Confidence level:very confident
Coverage over the Query: 173-419
View the alignment between query and template
View the model in PyMOL

Template: 1L1O, chain C
Confidence level:very confident
Coverage over the Query: 443-618
View the alignment between query and template
View the model in PyMOL

Template: 4GOP, chain C
Confidence level:very confident
Coverage over the Query: 174-618
View the alignment between query and template
View the model in PyMOL

Template: 2B29, chain A
Confidence level:confident
Coverage over the Query: 3-105
View the alignment between query and template
View the model in PyMOL

Template: 4GOP, chain C
Confidence level:confident
Coverage over the Query: 41-127,139-142,165-361
View the alignment between query and template
View the model in PyMOL