Citrus Sinensis ID: 007024

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-

MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLRKEAEARAEELKKSKQVTKPMNNLKKQGGQLQKGGFERGSNRSGGGSANDDGDSDNMRGRKLENGHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQKLRNKGGKKTDTVVSKGSNPDPKKKITKKNRVWDDSPPESKLDFTDPAGGNGSNIEVEAADHGESMMDKEEVFSSDSESEEDEEVGKHNKPDAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQDNEPLMRALSKLIYLNNPDLVLFVGEALVGNDAVDQLSKFNQKLADLSSSPNPQLIDGILLTKFDTIDDKVGAALSMVYVSGAPVMFVGCGQSYTDLKKLNVKSIVKTLLK

cccEEEEEccccEEEEEEcccccccccccHHHHHHHHHHcccccccccccccccccEEEEEEEEcccccEEEEEEccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccHHHHcccccccccccccHHHHHHHHccccccccHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHcccCEEEccccccHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHccccccccccccccEEEEEccccccccccEEEEEHHHccccEEEEEccccccccccccHHHHHHHHcc

MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLRK*****************************************************************************************************************************************************************************************************WFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQDNEPLMRALSKLIYLNNPDLVLFVGEALVGNDAVDQLSKFNQKLADLSSSPNPQLIDGILLTKFDTIDDKVGAALSMVYVSGAPVMFVGCGQSYTDLKKLNVKSIVKTLLK

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Signal recognition particle receptor subunit alpha	Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system.	probable	Q9DBG7
Signal recognition particle receptor subunit alpha	Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system.	probable	P08240
Signal recognition particle receptor subunit alpha homolog	Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system (By similarity). May have a role in axonogenesis.	probable	Q9U5L1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1J8M, chain F
Confidence level:very confident
Coverage over the Query: 314-552,563-620
View the alignment between query and template
View the model in PyMOL

Template: 2FH5, chain A
Confidence level:very confident
Coverage over the Query: 1-125
View the alignment between query and template
View the model in PyMOL