BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 007079
(619 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1YR2|A Chain A, Structural And Mechanistic Analysis Of Two Prolyl
Endopeptidases: Role Of Inter-Domain Dynamics In
Catalysis And Specificity
Length = 741
Score = 29.3 bits (64), Expect = 6.9, Method: Compositional matrix adjust.
Identities = 13/33 (39%), Positives = 18/33 (54%)
Query: 39 TGAKVGVSNSEGGGSYLDMWQKAVDRDRKEIEF 71
+G ++N GGG Y D W A RD+K+ F
Sbjct: 516 SGGAFALANLRGGGEYGDAWHDAGRRDKKQNVF 548
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.311 0.130 0.418
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 21,036,251
Number of Sequences: 62578
Number of extensions: 1005141
Number of successful extensions: 1468
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 1466
Number of HSP's gapped (non-prelim): 7
length of query: 619
length of database: 14,973,337
effective HSP length: 105
effective length of query: 514
effective length of database: 8,402,647
effective search space: 4318960558
effective search space used: 4318960558
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 54 (25.4 bits)