BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 007095
(618 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2GWD|A Chain A, Crystal Structure Of Plant Glutamate Cysteine Ligase In
Complex With Mg2+ And L-glutamate
Length = 449
Score = 35.8 bits (81), Expect = 0.064, Method: Compositional matrix adjust.
Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%)
Query: 149 HLFAAKRVAKEVGSSF--MVVESRIVRNSIPDNPSGEVDVMNKVQGLVSSL 197
HL+ K VA+E+G F M + + R IP P G D+M V SL
Sbjct: 119 HLYQVKAVAEEMGIGFLGMGFQPKWRREDIPTMPKGRYDIMRNYMPKVGSL 169
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.132 0.372
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,003,747
Number of Sequences: 62578
Number of extensions: 536254
Number of successful extensions: 1097
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 1096
Number of HSP's gapped (non-prelim): 4
length of query: 618
length of database: 14,973,337
effective HSP length: 105
effective length of query: 513
effective length of database: 8,402,647
effective search space: 4310557911
effective search space used: 4310557911
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)