BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 007100
(618 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit
In Complex With Initiation Factor 1. This File Contains
The 40s Subunit And Initiation Factor For Molecule 1
pdb|2XZN|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit
In Complex With Initiation Factor 1. This File Contains
The 40s Subunit And Initiation Factor For Molecule 2
Length = 343
Score = 32.7 bits (73), Expect = 0.61, Method: Compositional matrix adjust.
Identities = 27/73 (36%), Positives = 35/73 (47%), Gaps = 8/73 (10%)
Query: 3 VSPNGNFVACFTHDGRLVVNNTNFSSPVIDESCES-----ALPP--EQIAWCGMDSVLLY 55
V P + A DGRL V NTNF ++ ES ++ P + IA G D LL
Sbjct: 180 VQPFAPYFASVGWDGRLKVWNTNFQIRYTFKAHESNVNHLSISPNGKYIATGGKDKKLLI 239
Query: 56 WNDMLVMVAPQAE 68
W D+L + PQ E
Sbjct: 240 W-DILNLTYPQRE 251
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.134 0.399
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,118,739
Number of Sequences: 62578
Number of extensions: 601535
Number of successful extensions: 1189
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1188
Number of HSP's gapped (non-prelim): 2
length of query: 618
length of database: 14,973,337
effective HSP length: 105
effective length of query: 513
effective length of database: 8,402,647
effective search space: 4310557911
effective search space used: 4310557911
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)