BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 007162
(615 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3E1S|A Chain A, Structure Of An N-Terminal Truncation Of Deinococcus
Radiodurans Recd2
pdb|3GP8|A Chain A, Crystal Structure Of The Binary Complex Of Recd2 With Dna
pdb|3GPL|A Chain A, Crystal Structure Of The Ternary Complex Of Recd2 With Dna
And Adpnp
pdb|3GPL|B Chain B, Crystal Structure Of The Ternary Complex Of Recd2 With Dna
And Adpnp
Length = 574
Score = 31.6 bits (70), Expect = 1.5, Method: Compositional matrix adjust.
Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 12/72 (16%)
Query: 534 KTHRIQLSQEEQNLLDKTNGRRLI-----PGISKSQE----FSVAKKKGSKVWALCKSTG 584
K R LS+E+ ++LD+ G RL+ PG KS +A+ G +V LC TG
Sbjct: 184 KKARKGLSEEQASVLDQLAGHRLVVLTGGPGTGKSTTTKAVADLAESLGLEV-GLCAPTG 242
Query: 585 SSPNR--EMSGR 594
+ R E++GR
Sbjct: 243 KAARRLGEVTGR 254
>pdb|1W99|A Chain A, Mosquito-Larvicidal Toxin Cry4ba From Bacillus
Thuringiensis Ssp. Israelensis
Length = 558
Score = 29.6 bits (65), Expect = 5.4, Method: Compositional matrix adjust.
Identities = 12/33 (36%), Positives = 20/33 (60%)
Query: 471 LYHADKQKTDKYILELVIWLNRLISILRHKDHG 503
LY+ Q T +YI + W N+ + +LR+K +G
Sbjct: 126 LYNTMVQYTKEYIAHSITWYNKGLDVLRNKSNG 158
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.314 0.130 0.375
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 17,169,339
Number of Sequences: 62578
Number of extensions: 674023
Number of successful extensions: 1115
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1114
Number of HSP's gapped (non-prelim): 3
length of query: 615
length of database: 14,973,337
effective HSP length: 105
effective length of query: 510
effective length of database: 8,402,647
effective search space: 4285349970
effective search space used: 4285349970
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 54 (25.4 bits)