Citrus Sinensis ID: 007196

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610---

MSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESCTQTQKSIKSKNVENSGNNTGSNDEDNNGSIGVNGGDGSDDGSGTQSSWTKKAVEVDSPRHMSPSDQLAECPDSTCAQVIHSNAEITGSRRVPVTAAKECQDHEERCENFAKRSRDLDVGGQRSLDLQLEYQTESPIKLVGTKKTNRLDLGSSKLSEQIDRGQLDLNSESPSSKLKYEAAKLAGAITKIIDSDKEDTEYEASNKPSKILDINSKSIKDSKELPSLELSLKRLRGVKDIGTTIQDDRNVLRRSDSSAFSRYNTASNVNKGPGGNIESASQVVNSLEIIKKGSDCGIQSHSNGDPLNQSSNGGSNNMDMGSTTNNAFIKPAGLKNKSEVSSTVNCLHSSSFQPTKNDLLCSPRQVLLDKRDDLVASSVLVHPRSTQEQLTQHYDNCHHLVHNMQQQHLPHDHDQLSLKKMAEAVPQCGSSNMLGGFVEGNAGNYSINGSASGSNHGSNGQNGSSTAVNAGGMNVESDNGIAGKSGSGGASGSGSGSGNRIDKNKFADREAAVTKYRQKKTERCFRKKVRYQSRKRLAEQRPRIRGQFVRQTANENTSREPECS

ccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccHHHccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccccccccccccc

ccccccHHHHHHHHHHcHHHHEccHHcHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccHHHHccccccccccEEEccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccHHHHHHHHHccccHHHHHHcccccccccccccccccccccccccccEEEEEEcccccccccccccHHHHHcccccccHcEEccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccEEEHHHHHHHHHHccccccEEEEEccccccccccccc

mssldsmgLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRrchsssgsgsesctqTQKSiksknvensgnntgsndednngsigvnggdgsddgsgtqsswtkkavevdsprhmspsdqlaecpdstcaqvihsnaeitgsrrvpvtaakECQDHEERCENFAKrsrdldvggqrsLDLQLeyqtespiklvgtkktnrldlgssklseqidrgqldlnsespsskLKYEAAKLAGAITKIidsdkedteyeasnkpskildinsksikdskelpsLELSLKRLRgvkdigttiqddrnvlrrsdssafsryntasnvnkgpggnieSASQVVNSLEIIKkgsdcgiqshsngdplnqssnggsnnmdmgsttnnafikpaglknksevsstvnclhsssfqptkndllcsprqvlldkrddLVASSvlvhprstqeqLTQHYDNCHHLVHnmqqqhlphdhdqLSLKKMAEavpqcgssnmlggfvegnagnysingsasgsnhgsngqngsstavnaggmnvesdngiagksgsggasgsgsgsgnridknkfaDREAAVTKYRQKKTERCFRKKVRYQSRKRLAeqrprirgqFVRQTanentsrepecs

MSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHsssgsgsesctqtqksiksknvensgnntgsndednnGSIGVNGGDGSDDGSGTQSSWTKKAVEVDSPRHMSPSDQLAECPDSTCAQVIHsnaeitgsrrvpVTAAKECQDHEERCenfakrsrdldvggQRSLDLQleyqtespiklvgtkktnrldlgssklseqidrgqldlnsespssKLKYEAAKLAGAITKiidsdkedteyeasnkpskildinsksikdskelpslelslkrlrgvkdigttiqddrnvlrrsdssafsryntasnvnkgpggniESASQVVNSLEIIKKGSDCGIQSHSNGDPLNQSSNGGSNNMDMGSTTNNAFIKPAGLKNKSEVSSTVNCLHsssfqptkndllCSPRQVLLDKRDDLVASSVLVHPRSTQEQLTQHYDNCHHLVHNMQQQHLPHDHDQLSLKKMAEAVPQCGSSNMLGGFVEGNAGNYSINGSASGSNHGSNGQNGSSTAVNAGGMNVESDNgiagksgsggasgsgsgsgnridknkfadreaavtkyrqkktercfrkkvryqsrkrlaeqrprirgqfvrqtanentsrepecs

MSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHsssgsgsesCTQTQKSIKSKNVENSGNNTGSNDEdnngsigvnggdgsddgsgTQSSWTKKAVEVDSPRHMSPSDQLAECPDSTCAQVIHSNAEITGSRRVPVTAAKECQDHEERCENFAKRSRDLDVGGQRSLDLQLEYQTESPIKLVGTKKTNRLDLGSSKLSEQIDRGQLDLNSESPSSKLKYEAAKLAGAITKIIDSDKEDTEYEASNKPSKILDINSKSIKDSkelpslelslkrlrGVKDIGTTIQDDRNVLRRSDSSAFSRYNTASNVNKGPGGNIESASQVVNSLEIIKKGSDCGIQSHSNGDPLNQSSNGGSNNMDMGSTTNNAFIKPAGLKNKSEVSSTVNCLHSSSFQPTKNDLLCSPRQVLLDKRDDLVASSVLVHPRSTQEQLTQHYDNCHHLVHNMqqqhlphdhdqlSLKKMAEAVPQCGSSNMLGGFVEGNAGNYsingsasgsnhgsngqngssTAVNAGGMNVESDNgiagksgsggasgsgsgsgNRIDKNKFADREAAVTKYRQKKTERCFRKKVRYQSRKRLAEQRPRIRGQFVRQTANENTSREPECS

******MGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRC**************************************************************************************************************************************************************************************************AIT************************************************************************************************************************************************************************LLCSPRQVLLDKRDDLVASSVLVH*******LTQHYDNCHHLVHN*****************************************************************************************************************************************************************

******M***FKCLSKGAVDFLVKPIRKNELKNLWQHVW*************************************************************************************************************************************************************************************************************************************************************************DSSAF***************************************************************************************************************************************NCHHLVH*****************************************************************************************************************YRQKKTERCFRKKVRYQSRKRLAEQRPRIRGQFV***************

MSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRR**********************NVENSGNNTGSNDEDNNGSIGVNGG***********************************PDSTCAQVIHSNAEITGSRRVPVTAAKECQDHEERCENFAKRSRDLDVGGQRSLDLQLEYQTESPIKLVGTKKTNRLDLGSSKLSEQIDRGQLDLNSESPSSKLKYEAAKLAGAITKIIDSD**********KPSKILDINSKSIKDSKELPSLELSLKRLRGVKDIGTTIQDDRNVLRRSDSSAFSRYNTASNVNKGPGGNIESASQVVNSLEIIKKGSDCGIQSHSNGDPLNQSSNGGSNNMDMGSTTNNAFIKPAGL***********CLHSSSFQPTKNDLLCSPRQVLLDKRDDLVASSVLVHPRSTQEQLTQHYDNCHHLVHNMQQQHLPHDHDQLSLKKMAEAVPQCGSSNMLGGFVEGNAGNYSINGSA***********GSSTAVNAGGMNVESDNGIAG***************NRIDKNKFADREAAVTKYRQKKTERCFRKKVRYQSRKRLAEQRPRIRGQFVR**************

*****SMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCH**********************************************************************MSPSDQLAECPDSTCAQVIHSNAEITGSRRVPVTA**********C**F*K*S*DL************************************************************E*AKLAGAITKIIDSDKEDTEYE******************SKELPSLELSLKRLRG*****TTIQDDR*VLRRSDSSAFSRYNTA************************************************************************************************************************************************************************************************************************************************ADREAAVTKYRQKKTERCFRKKVRYQSRKRLAEQRPRIRGQFVRQT************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		613	2.2.26 [Sep-21-2011]
Q93WK5		727	Two-component response re	yes	no	0.880	0.742	0.529	1e-123
A2XFB7		767	Two-component response re	N/A	no	0.960	0.767	0.461	1e-110
Q10N34		767	Two-component response re	yes	no	0.960	0.767	0.461	1e-110
A2YQ93		742	Two-component response re	N/A	no	0.920	0.760	0.480	1e-103
Q0D3B6		742	Two-component response re	no	no	0.920	0.760	0.482	1e-103
Q9LVG4		495	Two-component response re	no	no	0.420	0.521	0.388	2e-33
Q689G6		623	Two-component response re	no	no	0.172	0.170	0.436	9e-16
Q8L500		468	Two-component response re	no	no	0.154	0.202	0.465	1e-15
Q6LA42		558	Two-component response re	no	no	0.052	0.057	0.727	3e-13
Q9LKL2		618	Two-component response re	no	no	0.099	0.098	0.524	1e-12

>sp\|Q93WK5\|APRR7_ARATH Two-component response regulator-like APRR7 OS=Arabidopsis thaliana GN=APRR7 PE=2 SV=1	Back alignment and function desciption

 Score =  441 bits (1134), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 327/617 (52%), Positives = 401/617 (64%), Gaps = 77/617 (12%)

Query: 1   MSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESCT-QTQKS 59
           MSS DSMGLVFKCLSKGAVDFLVKPIRKNELK LWQHVWRRC SSSGSGSES T QTQKS
Sbjct: 159 MSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKILWQHVWRRCQSSSGSGSESGTHQTQKS 218

Query: 60  IKSKNVENSGNNTGSNDEDNNGSIGVNGGDGSDDGSGTQSSWTKKAVEVD-SPRHMSPSD 118
           +KSK+++ S  ++GS+DE+ NGSIG+N  DGS DGSG QSSWTKKAV+VD SPR +S  D
Sbjct: 219 VKSKSIKKSDQDSGSSDENENGSIGLNASDGSSDGSGAQSSWTKKAVDVDDSPRAVSLWD 278

Query: 119 QLAECPDSTCAQVIHSNAEITGSRRVPVTAAKECQDHEERCENFAKRSRDLDVGGQRSLD 178
           ++    DSTCAQV+HSN E   ++ V   A KE Q+H+++ E+     RDL++  +R+ D
Sbjct: 279 RV----DSTCAQVVHSNPEFPSNQLVAPPAEKETQEHDDKFEDVTM-GRDLEISIRRNCD 333

Query: 179 LQLEYQTESPIKLVGT-KKTNRLDLGSSKLSEQIDRGQLDLNSESPSSKLKYEAAKLAGA 237
           L LE + E   K  G  ++ N  +  SSK   ++ +G LDL+SESPSSK  +E     G+
Sbjct: 334 LALEPKDEPLSKTTGIMRQDNSFEKSSSKWKMKVGKGPLDLSSESPSSKQMHEDG---GS 390

Query: 238 ITKIIDSDKEDT-EYEASNKPSKILDINSKSIKDSKELPSLELSLKRLRGVKDIGTTIQD 296
             K + S  +D  E EA N   K LD N  S+K S+EL  +E S KR RG KD GT ++D
Sbjct: 391 SFKAMSSHLQDNREPEAPNTHLKTLDTNEASVKISEELMHVEHSSKRHRGTKDDGTLVRD 450

Query: 297 DRNVLRRSDSSAFSRYNTASNVNKGPGGNIESAS-QVVNSLEIIKKGSDCGIQSHSNGD- 354
           DRNVLRRS+ SAFSRYN ASN NK  GGN+ S S Q  NS ++IKK ++     HSN + 
Sbjct: 451 DRNVLRRSEGSAFSRYNPASNANKISGGNLGSTSLQDNNSQDLIKK-TEAAYDCHSNMNE 509

Query: 355 --PLNQSSNGGSNNMDMGSTT-NNAFIKPAGLKNKSEVSSTVNCLHSSSFQPTKNDLLCS 411
             P N  S+ GSNN DM STT NNAF KP   K  S  SS+V     SSFQP    L C 
Sbjct: 510 SLPHNHRSHVGSNNFDMSSTTENNAFTKPGAPKVSSAGSSSVK---HSSFQP----LPC- 561

Query: 412 PRQVLLDKRDDLVASSVLVHPRSTQEQLTQHYDN--CHHLVHNMQQQHLPHDHDQLSLKK 469
                                         H++N   ++LVH  +++ LP          
Sbjct: 562 -----------------------------DHHNNHASYNLVHVAERKKLP---------- 582

Query: 470 MAEAVPQCGSSNMLGGFVEGN--AGNYSINGSASGSNHGSNGQNGSSTAVNAGGMNVESD 527
                PQCGSSN+    +EGN    NYS+NGS SGS HGSNG  GSS  +NAGGMN+ SD
Sbjct: 583 -----PQCGSSNVYNETIEGNNNTVNYSVNGSVSGSGHGSNGPYGSSNGMNAGGMNMGSD 637

Query: 528 NGIAGKSGSGGASGSGSGSGNR--IDKNKFADREAAVTKYRQKKTERCFRKKVRYQSRKR 585
           NG AGK+G+G  SGSGSGSG+    D+NK + REAA+TK+RQK+ ERCFRKKVRYQSRK+
Sbjct: 638 NG-AGKNGNGDGSGSGSGSGSGNLADENKISQREAALTKFRQKRKERCFRKKVRYQSRKK 696

Query: 586 LAEQRPRIRGQFVRQTA 602
           LAEQRPR+RGQFVR+TA
Sbjct: 697 LAEQRPRVRGQFVRKTA 713

Controls photoperiodic flowering response. Seems to be one of the component of the circadian clock. Expression of several members of the ARR-like family is controlled by circadian rhythm. The particular coordinated sequential expression of APRR9, APRR7, APRR5, APRR3 and APPR1 result to circadian waves that may be at the basis of the endogenous circadian clock.
Arabidopsis thaliana (taxid: 3702)

>sp\|A2XFB7\|PRR73_ORYSI Two-component response regulator-like PRR73 OS=Oryza sativa subsp. indica GN=PRR73 PE=2 SV=2	Back alignment and function description

>sp\|Q10N34\|PRR73_ORYSJ Two-component response regulator-like PRR73 OS=Oryza sativa subsp. japonica GN=PRR73 PE=2 SV=1	Back alignment and function description

>sp\|A2YQ93\|PRR37_ORYSI Two-component response regulator-like PRR37 OS=Oryza sativa subsp. indica GN=PRR37 PE=2 SV=2	Back alignment and function description

>sp\|Q0D3B6\|PRR37_ORYSJ Two-component response regulator-like PRR37 OS=Oryza sativa subsp. japonica GN=PRR37 PE=2 SV=1	Back alignment and function description

>sp\|Q9LVG4\|APRR3_ARATH Two-component response regulator-like APRR3 OS=Arabidopsis thaliana GN=APRR3 PE=1 SV=1	Back alignment and function description

>sp\|Q689G6\|PRR95_ORYSJ Two-component response regulator-like PRR95 OS=Oryza sativa subsp. japonica GN=PRR95 PE=2 SV=1	Back alignment and function description

>sp\|Q8L500\|APRR9_ARATH Two-component response regulator-like APRR9 OS=Arabidopsis thaliana GN=APRR9 PE=2 SV=2	Back alignment and function description

>sp\|Q6LA42\|APRR5_ARATH Two-component response regulator-like APRR5 OS=Arabidopsis thaliana GN=APRR5 PE=1 SV=2	Back alignment and function description

>sp\|Q9LKL2\|APRR1_ARATH Two-component response regulator-like APRR1 OS=Arabidopsis thaliana GN=APRR1 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		613
255568450		762	sensory transduction histidine kinase, p	0.952	0.766	0.609	0.0
449524812		794	PREDICTED: two-component response regula	0.975	0.753	0.596	0.0
449448936		797	PREDICTED: two-component response regula	0.964	0.741	0.599	0.0
356545957		749	PREDICTED: two-component response regula	0.933	0.763	0.593	1e-179
356536913		747	PREDICTED: two-component response regula	0.934	0.767	0.595	1e-177
225435163		785	PREDICTED: two-component response regula	0.949	0.741	0.531	1e-149
157399678		784	pseudo-response regulator 7 [Castanea sa	0.972	0.760	0.517	1e-145
224098126		766	pseudo response regulator [Populus trich	0.938	0.750	0.505	1e-141
224098134		711	predicted protein [Populus trichocarpa]	0.938	0.808	0.505	1e-141
255582079		807	sensory transduction histidine kinase, p	0.983	0.747	0.508	1e-138

>gi\|255568450\|ref\|XP_002525199.1\| sensory transduction histidine kinase, putative [Ricinus communis] gi\|223535496\|gb\|EEF37165.1\| sensory transduction histidine kinase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/620 (60%), Positives = 458/620 (73%), Gaps = 36/620 (5%)

Query: 1   MSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESCTQTQKSI 60
           MSS DSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSES T+TQKS+
Sbjct: 169 MSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESGTETQKSV 228

Query: 61  KSKNVENSGNNTGSNDEDNNGSIGVNGGDGSDDGSGTQSSWTKKAVEVDSPRHMSPSDQL 120
           KSK+VE SGN+TGS+DED+NGSIG+N GDGSD+GSGTQSSWTK+AVEVDSPR +SP DQ+
Sbjct: 229 KSKSVEKSGNDTGSSDEDDNGSIGLNVGDGSDNGSGTQSSWTKQAVEVDSPRPVSPMDQV 288

Query: 121 AECPDSTCAQVIHSNAEITGSRRVPVTAAKECQDHEERCENFAKRSRDLDVGGQRSLDLQ 180
           AECPDSTCAQVIHSNAE++G+++ P+  AKEC++ EE+ ++ A  ++DL+     ++DLQ
Sbjct: 289 AECPDSTCAQVIHSNAEVSGTKQTPIITAKECEEQEEQLDSAA--AKDLEKVVPGNVDLQ 346

Query: 181 LEYQTESPIKLVGTKKTNRLDLGSSKLSEQIDRGQLDLNSESPSSKLKYEAAKLAGAITK 240
           LE Q   PIK VGTK+ N L+ GS    E+ID+ QLD NSE+PSSK +YEAA L G  T 
Sbjct: 347 LECQVADPIKFVGTKQKNLLERGSGNYKEKIDKEQLDQNSENPSSKSRYEAANLTGFTTN 406

Query: 241 IIDSDKEDTEYEASNKPSKILDINSKSIKDSKELPSLELSLKRLRGVKDIGTTIQDDRNV 300
            ID   + TE EA+N+   ILDI +K   D+KE+P+ ELSLKR RG KD+GT +Q+DRNV
Sbjct: 407 TIDPHMDSTEIEATNRHCNILDIKNKPSNDAKEIPTFELSLKRNRGAKDVGTVVQEDRNV 466

Query: 301 LRRSDSSAFSRYNTASNVNKGPGGNIESASQVVNSLEIIKKGSDCGIQSHSNGDPLNQSS 360
           LRRSDSSAFSRYN +SN  K P  N+ S S   +SL++ +KG+ C ++SHSN +  N  S
Sbjct: 467 LRRSDSSAFSRYNASSNAKKAPCANMTSGSHYGSSLDVTEKGTVCDLKSHSNSNLPNHCS 526

Query: 361 NGGSNNMDMGSTTNNAFIKPAGLKNKSEVSSTVNCLHSSSFQPTKNDLLCSPRQVLLDKR 420
           N GSNN+DMGSTTN+A  K   LKNKS           S+FQ  ++D LC+ +Q+L +K 
Sbjct: 527 NVGSNNIDMGSTTNHAITKSVVLKNKSGHP-------PSTFQAMRDDPLCATQQILKEKA 579

Query: 421 DDLVASSVLVHPRSTQEQL-----TQHYDNCHHLVHNMQQQHLPHDHDQLSLKKMAEAVP 475
           DD   + +L  P  +  +      T HY++ HHL HNMQ                 ++VP
Sbjct: 580 DDTAGAMLLAQPGGSLSECKIQHQTHHYNHYHHLPHNMQTAQ--------------QSVP 625

Query: 476 QCGSSNMLGGFVEGNAGNYSINGSASGSNHG----SNGQNGSSTAVNAGGMNVESDNGIA 531
            CGSSN+LGG +EGN GNYSINGSASGSNHG    SNGQNGSSTAVNAGG NVESDN   
Sbjct: 626 HCGSSNVLGGPLEGNGGNYSINGSASGSNHGSNHVSNGQNGSSTAVNAGGTNVESDN--- 682

Query: 532 GKSGSGGASGSGSGSGNRIDKNKFADREAAVTKYRQKKTERCFRKKVRYQSRKRLAEQRP 591
              G    SG GSG GNR D+NKF+ RE A+TK+RQK+ ERCFRKKVRYQSRKRLAEQRP
Sbjct: 683 -GIGGKSGSGDGSGEGNRGDQNKFSQREVALTKFRQKRKERCFRKKVRYQSRKRLAEQRP 741

Query: 592 RIRGQFVRQTANENTSREPE 611
           R+RGQFVRQT N +TS+  E
Sbjct: 742 RVRGQFVRQTGNGSTSKASE 761

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|449524812\|ref\|XP_004169415.1\| PREDICTED: two-component response regulator-like APRR7-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449448936\|ref\|XP_004142221.1\| PREDICTED: two-component response regulator-like APRR7-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356545957\|ref\|XP_003541399.1\| PREDICTED: two-component response regulator-like APRR7-like [Glycine max]	Back alignment and taxonomy information

>gi\|356536913\|ref\|XP_003536977.1\| PREDICTED: two-component response regulator-like APRR7-like [Glycine max]	Back alignment and taxonomy information

>gi\|225435163\|ref\|XP_002281776.1\| PREDICTED: two-component response regulator-like PRR73-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|157399678\|gb\|ABV53463.1\| pseudo-response regulator 7 [Castanea sativa]	Back alignment and taxonomy information

>gi\|224098126\|ref\|XP_002311123.1\| pseudo response regulator [Populus trichocarpa] gi\|222850943\|gb\|EEE88490.1\| pseudo response regulator [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224098134\|ref\|XP_002311124.1\| predicted protein [Populus trichocarpa] gi\|222850944\|gb\|EEE88491.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255582079\|ref\|XP_002531836.1\| sensory transduction histidine kinase, putative [Ricinus communis] gi\|223528532\|gb\|EEF30556.1\| sensory transduction histidine kinase, putative [Ricinus communis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		613
TAIR\|locus:2151206		727	PRR7 "pseudo-response regulato	0.644	0.543	0.480	2e-81
TAIR\|locus:2044376		468	PRR9 "pseudo-response regulato	0.083	0.108	0.653	1.1e-25
TAIR\|locus:2163198		618	TOC1 "TIMING OF CAB EXPRESSION	0.104	0.103	0.484	1.5e-19
TAIR\|locus:2062749		183	AT2G46670 "AT2G46670" [Arabido	0.083	0.278	0.653	2.1e-14
TAIR\|locus:2172545		355	COL5 "CONSTANS-like 5" [Arabid	0.079	0.138	0.551	4.9e-07
TAIR\|locus:2047246		294	COL3 "CONSTANS-like 3" [Arabid	0.081	0.170	0.529	1.9e-06
TAIR\|locus:2031581		392	BBX16 "B-box domain protein 16	0.075	0.117	0.543	1.9e-06
TAIR\|locus:2175564		435	CIA2 "chloroplast import appar	0.078	0.110	0.551	3.4e-06
TAIR\|locus:2007482		195	AT1G07050 "AT1G07050" [Arabido	0.083	0.261	0.450	4.4e-06
UNIPROTKB\|Q9FDX8		395	HD1 "Zinc finger protein HD1"	0.073	0.113	0.533	9e-06

TAIR\|locus:2151206 PRR7 "pseudo-response regulator 7" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 817 (292.7 bits), Expect = 2.0e-81, P = 2.0e-81
 Identities = 200/416 (48%), Positives = 247/416 (59%)

Query:     1 MSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHXXXXXXXXXCT-QTQKS 59
             MSS DSMGLVFKCLSKGAVDFLVKPIRKNELK LWQHVWRRC           T QTQKS
Sbjct:   159 MSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKILWQHVWRRCQSSSGSGSESGTHQTQKS 218

Query:    60 IKSKNVENSGNNTGSNDEXXXXXXXXXXXXXXXXXXXTQSSWTKKAVEVD-SPRHMSPSD 118
             +KSK+++ S  ++GS+DE                    QSSWTKKAV+VD SPR +S  D
Sbjct:   219 VKSKSIKKSDQDSGSSDENENGSIGLNASDGSSDGSGAQSSWTKKAVDVDDSPRAVSLWD 278

Query:   119 QLAECPDSTCAQVIHSNAEITGSRRVPVTAAKECQDHEERCENFAKRSRDLDVGGQRSLD 178
             ++    DSTCAQV+HSN E   ++ V   A KE Q+H+++ E+     RDL++  +R+ D
Sbjct:   279 RV----DSTCAQVVHSNPEFPSNQLVAPPAEKETQEHDDKFEDVTM-GRDLEISIRRNCD 333

Query:   179 LQLEYQTESPIKLVGT-KKTNRLDLGSSKLSEQIDRGQLDLNSESPSSKLKYEAAKLAGA 237
             L LE + E   K  G  ++ N  +  SSK   ++ +G LDL+SESPSSK  +E     G+
Sbjct:   334 LALEPKDEPLSKTTGIMRQDNSFEKSSSKWKMKVGKGPLDLSSESPSSKQMHEDG---GS 390

Query:   238 ITKIIDSDKEDT-EYEASNKPSKILDINSKSIKDSXXXXXXXXXXXXXXGVKDIGTTIQD 296
               K + S  +D  E EA N   K LD N  S+K S              G KD GT ++D
Sbjct:   391 SFKAMSSHLQDNREPEAPNTHLKTLDTNEASVKISEELMHVEHSSKRHRGTKDDGTLVRD 450

Query:   297 DRNVLRRSDSSAFSRYNTASNVNKGPGGNIESAS-QVVNSLEIIKKGSDCGIQSHSNGD- 354
             DRNVLRRS+ SAFSRYN ASN NK  GGN+ S S Q  NS ++IKK ++     HSN + 
Sbjct:   451 DRNVLRRSEGSAFSRYNPASNANKISGGNLGSTSLQDNNSQDLIKK-TEAAYDCHSNMNE 509

Query:   355 --PLNQSSNGGSNNMDMGSTT-NNAFIKPAGLKNKSEVSSTVNCLHSSSFQPTKND 407
               P N  S+ GSNN DM STT NNAF KP   K  S  SS+V   HSS FQP   D
Sbjct:   510 SLPHNHRSHVGSNNFDMSSTTENNAFTKPGAPKVSSAGSSSVK--HSS-FQPLPCD 562

GO:0000156 "phosphorelay response regulator activity" evidence=IEA;ISS

GO:0000160 "phosphorelay signal transduction system" evidence=IEA

GO:0005634 "nucleus" evidence=ISM;IDA

GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;TAS

GO:0007623 "circadian rhythm" evidence=IMP;TAS

GO:0010017 "red or far-red light signaling pathway" evidence=IMP

GO:0005739 "mitochondrion" evidence=IDA

GO:0009266 "response to temperature stimulus" evidence=IGI

GO:0003677 "DNA binding" evidence=IPI

GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IDA

GO:0009639 "response to red or far red light" evidence=RCA

GO:0042752 "regulation of circadian rhythm" evidence=RCA

GO:0048574 "long-day photoperiodism, flowering" evidence=RCA

TAIR\|locus:2044376 PRR9 "pseudo-response regulator 9" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2163198 TOC1 "TIMING OF CAB EXPRESSION 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2062749 AT2G46670 "AT2G46670" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2172545 COL5 "CONSTANS-like 5" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2047246 COL3 "CONSTANS-like 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2031581 BBX16 "B-box domain protein 16" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2175564 CIA2 "chloroplast import apparatus 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2007482 AT1G07050 "AT1G07050" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9FDX8 HD1 "Zinc finger protein HD1" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q93WK5	APRR7_ARATH	No assigned EC number	0.5299	0.8809	0.7427	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		613
pfam06203		45	pfam06203, CCT, CCT motif	5e-19
cd00156		113	cd00156, REC, Signal receiver domain; originally t	0.003

>gnl\|CDD\|203407 pfam06203, CCT, CCT motif	Back alignment and domain information

 Score = 80.3 bits (199), Expect = 5e-19
 Identities = 24/44 (54%), Positives = 36/44 (81%)

Query: 558 REAAVTKYRQKKTERCFRKKVRYQSRKRLAEQRPRIRGQFVRQT 601
           REAA+ +Y++K+  R F KK+RY SRK +AE RPR++G+FV+Q+
Sbjct: 1   REAALLRYKEKRKTRKFDKKIRYASRKAVAESRPRVKGRFVKQS 44

This short motif is found in a number of plant proteins. It is rich in basic amino acids and has been called a CCT motif after Co, Col and Toc1. The CCT motif is about 45 amino acids long and contains a putative nuclear localisation signal within the second half of the CCT motif. Toc1 mutants have been identified in this region. Length = 45

>gnl|CDD|238088 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers

Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		613
PF06203		45	CCT: CCT motif; InterPro: IPR010402 The CCT (CONST	99.71
COG4753		475	Response regulator containing CheY-like receiver d	98.21
COG4565		224	CitB Response regulator of citrate/malate metaboli	97.56
COG2204		464	AtoC Response regulator containing CheY-like recei	97.1
COG4566		202	TtrR Response regulator [Signal transduction mecha	97.05
COG0745		229	OmpR Response regulators consisting of a CheY-like	96.71
PRK09581		457	pleD response regulator PleD; Reviewed	96.62
PLN03029		222	type-a response regulator protein; Provisional	96.51
PRK10046		225	dpiA two-component response regulator DpiA; Provis	96.13
PRK10529		225	DNA-binding transcriptional activator KdpE; Provis	95.94
COG4567		182	Response regulator consisting of a CheY-like recei	95.87
PRK10643		222	DNA-binding transcriptional regulator BasR; Provis	95.86
TIGR03787		227	marine_sort_RR proteobacterial dedicated sortase s	95.84
PRK10766		221	DNA-binding transcriptional regulator TorR; Provis	95.81
PRK10336		219	DNA-binding transcriptional regulator QseB; Provis	95.79
PRK10161		229	transcriptional regulator PhoB; Provisional	95.74
PRK11173		237	two-component response regulator; Provisional	95.62
PRK09836		227	DNA-binding transcriptional activator CusR; Provis	95.58
PRK10816		223	DNA-binding transcriptional regulator PhoP; Provis	95.55
PRK10610		129	chemotaxis regulatory protein CheY; Provisional	95.49
CHL00148		240	orf27 Ycf27; Reviewed	95.46
TIGR02154		226	PhoB phosphate regulon transcriptional regulatory	95.42
PRK10430		239	DNA-binding transcriptional activator DcuR; Provis	95.37
PRK09468		239	ompR osmolarity response regulator; Provisional	95.3
PRK10955		232	DNA-binding transcriptional regulator CpxR; Provis	95.3
PRK10693		303	response regulator of RpoS; Provisional	95.29
TIGR02915		445	PEP_resp_reg putative PEP-CTERM system response re	95.21
PF09425		27	CCT_2: Divergent CCT motif; InterPro: IPR018467 Th	95.2
PRK10360		196	DNA-binding transcriptional activator UhpA; Provis	95.14
TIGR01387		218	cztR_silR_copR heavy metal response regulator. Mem	95.07
PRK11517		223	transcriptional regulatory protein YedW; Provision	95.02
KOG1601		340	consensus GATA-4/5/6 transcription factors [Transc	94.97
PRK11083		228	DNA-binding response regulator CreB; Provisional	94.91
PRK10840		216	transcriptional regulator RcsB; Provisional	94.89
PRK09958		204	DNA-binding transcriptional activator EvgA; Provis	94.83
TIGR02875		262	spore_0_A sporulation transcription factor Spo0A.	94.79
PRK09935		210	transcriptional regulator FimZ; Provisional	94.59
PRK13856		241	two-component response regulator VirG; Provisional	94.57
PRK10701		240	DNA-binding transcriptional regulator RstA; Provis	94.47
PRK11697		238	putative two-component response-regulatory protein	94.28
PRK15479		221	transcriptional regulatory protein TctD; Provision	94.28
PRK14084		246	two-component response regulator; Provisional	94.09
PRK13435		145	response regulator; Provisional	93.68
PRK10710		240	DNA-binding transcriptional regulator BaeR; Provis	93.63
PRK09483		217	response regulator; Provisional	93.3
PRK10923		469	glnG nitrogen regulation protein NR(I); Provisiona	93.26
PRK15115		444	response regulator GlrR; Provisional	93.02
PRK11475		207	DNA-binding transcriptional activator BglJ; Provis	93.01
PRK10365		441	transcriptional regulatory protein ZraR; Provision	92.97
PRK10403		215	transcriptional regulator NarP; Provisional	92.92
PRK11361		457	acetoacetate metabolism regulatory protein AtoC; P	92.69
COG2197		211	CitB Response regulator containing a CheY-like rec	92.67
COG0784		130	CheY FOG: CheY-like receiver [Signal transduction	92.56
TIGR01818		463	ntrC nitrogen regulation protein NR(I). This model	92.42
PRK15369		211	two component system sensor kinase SsrB; Provision	92.39
PRK09581		457	pleD response regulator PleD; Reviewed	92.38
PRK11107		919	hybrid sensory histidine kinase BarA; Provisional	91.76
PRK10651		216	transcriptional regulator NarL; Provisional	91.42
COG3437		360	Response regulator containing a CheY-like receiver	91.29
PRK15347		921	two component system sensor kinase SsrA; Provision	90.75
COG3707		194	AmiR Response regulator with putative antiterminat	90.73
cd00156		113	REC Signal receiver domain; originally thought to	90.07
COG3706		435	PleD Response regulator containing a CheY-like rec	89.72
PRK11466		914	hybrid sensory histidine kinase TorS; Provisional	89.55
TIGR02956		968	TMAO_torS TMAO reductase sytem sensor TorS. This p	88.45
PRK09390		202	fixJ response regulator FixJ; Provisional	87.95
TIGR03815		322	CpaE_hom_Actino helicase/secretion neighborhood Cp	87.5
PRK09959		1197	hybrid sensory histidine kinase in two-component r	87.36
PRK12555		337	chemotaxis-specific methylesterase; Provisional	83.4
PRK11091		779	aerobic respiration control sensor protein ArcB; P	81.32

>PF06203 CCT: CCT motif; InterPro: IPR010402 The CCT (CONSTANS, CO-like, and TOC1) domain is a highly conserved basic module of ~43 amino acids, which is found near the C terminus of plant proteins often involved in light signal transduction	Back alignment and domain information

Probab=99.71  E-value=2.7e-18  Score=132.77  Aligned_cols=45  Identities=47%  Similarity=0.976  Sum_probs=43.2

Q ss_pred             HHHHHHHHHHhhhccCCCCcccchhhhhhhhhCCCCCccccccCC
Q 007196          558 REAAVTKYRQKKTERCFRKKVRYQSRKRLAEQRPRIRGQFVRQTA  602 (613)
Q Consensus       558 R~~~l~RyreKrk~R~f~KkirY~~RK~~A~~RpRvKGrFvk~~~  602 (613)
                      |+++|+||++||++|+|+|+|+|++||.+|+.|||||||||+..+
T Consensus         1 R~~~l~Ry~~Kr~~R~f~kkirY~~Rk~~A~~R~RvkGRFvk~~e   45 (45)
T PF06203_consen    1 REEKLQRYREKRKRRNFEKKIRYESRKAVADKRPRVKGRFVKKSE   45 (45)
T ss_pred             CHHHHHHHHHHHHhhcccccCCcchHHHHHhhCCccCCcccCCCC
Confidence            789999999999999999999999999999999999999999864

The CCT domain is found in association with other domains, such as the B-box zinc finger, the GATA-type zinc finger, the ZIM motif or the response regulatory domain. The CCT domain contains a putative nuclear localisation signal within the second half of the CCT motif and has been shown to be involved in nuclear localization and probably also has a role in protein-protein interaction [].; GO: 0005515 protein binding

>COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms]	Back alignment and domain information

>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]	Back alignment and domain information

>COG4566 TtrR Response regulator [Signal transduction mechanisms]	Back alignment and domain information

>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]	Back alignment and domain information

>PRK09581 pleD response regulator PleD; Reviewed	Back alignment and domain information

>PLN03029 type-a response regulator protein; Provisional	Back alignment and domain information

>PRK10046 dpiA two-component response regulator DpiA; Provisional	Back alignment and domain information

>PRK10529 DNA-binding transcriptional activator KdpE; Provisional	Back alignment and domain information

>COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription]	Back alignment and domain information

>PRK10643 DNA-binding transcriptional regulator BasR; Provisional	Back alignment and domain information

>TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator	Back alignment and domain information

>PRK10766 DNA-binding transcriptional regulator TorR; Provisional	Back alignment and domain information

>PRK10336 DNA-binding transcriptional regulator QseB; Provisional	Back alignment and domain information

>PRK10161 transcriptional regulator PhoB; Provisional	Back alignment and domain information

>PRK11173 two-component response regulator; Provisional	Back alignment and domain information

>PRK09836 DNA-binding transcriptional activator CusR; Provisional	Back alignment and domain information

>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional	Back alignment and domain information

>PRK10610 chemotaxis regulatory protein CheY; Provisional	Back alignment and domain information

>CHL00148 orf27 Ycf27; Reviewed	Back alignment and domain information

>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB	Back alignment and domain information

>PRK10430 DNA-binding transcriptional activator DcuR; Provisional	Back alignment and domain information

>PRK09468 ompR osmolarity response regulator; Provisional	Back alignment and domain information

>PRK10955 DNA-binding transcriptional regulator CpxR; Provisional	Back alignment and domain information

>PRK10693 response regulator of RpoS; Provisional	Back alignment and domain information

>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator	Back alignment and domain information

>PF09425 CCT_2: Divergent CCT motif; InterPro: IPR018467 The short CCT (CO, COL, TOC1) motif is found in a number of plant proteins, including Constans (CO), Constans-like (COL) and TOC1	Back alignment and domain information

>PRK10360 DNA-binding transcriptional activator UhpA; Provisional	Back alignment and domain information

>TIGR01387 cztR_silR_copR heavy metal response regulator	Back alignment and domain information

>PRK11517 transcriptional regulatory protein YedW; Provisional	Back alignment and domain information

>KOG1601 consensus GATA-4/5/6 transcription factors [Transcription]	Back alignment and domain information

>PRK11083 DNA-binding response regulator CreB; Provisional	Back alignment and domain information

>PRK10840 transcriptional regulator RcsB; Provisional	Back alignment and domain information

>PRK09958 DNA-binding transcriptional activator EvgA; Provisional	Back alignment and domain information

>TIGR02875 spore_0_A sporulation transcription factor Spo0A	Back alignment and domain information

>PRK09935 transcriptional regulator FimZ; Provisional	Back alignment and domain information

>PRK13856 two-component response regulator VirG; Provisional	Back alignment and domain information

>PRK10701 DNA-binding transcriptional regulator RstA; Provisional	Back alignment and domain information

>PRK11697 putative two-component response-regulatory protein YehT; Provisional	Back alignment and domain information

>PRK15479 transcriptional regulatory protein TctD; Provisional	Back alignment and domain information

>PRK14084 two-component response regulator; Provisional	Back alignment and domain information

>PRK13435 response regulator; Provisional	Back alignment and domain information

>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional	Back alignment and domain information

>PRK09483 response regulator; Provisional	Back alignment and domain information

>PRK10923 glnG nitrogen regulation protein NR(I); Provisional	Back alignment and domain information

>PRK15115 response regulator GlrR; Provisional	Back alignment and domain information

>PRK11475 DNA-binding transcriptional activator BglJ; Provisional	Back alignment and domain information

>PRK10365 transcriptional regulatory protein ZraR; Provisional	Back alignment and domain information

>PRK10403 transcriptional regulator NarP; Provisional	Back alignment and domain information

>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional	Back alignment and domain information

>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]	Back alignment and domain information

>COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms]	Back alignment and domain information

>TIGR01818 ntrC nitrogen regulation protein NR(I)	Back alignment and domain information

>PRK15369 two component system sensor kinase SsrB; Provisional	Back alignment and domain information

>PRK09581 pleD response regulator PleD; Reviewed	Back alignment and domain information

>PRK11107 hybrid sensory histidine kinase BarA; Provisional	Back alignment and domain information

>PRK10651 transcriptional regulator NarL; Provisional	Back alignment and domain information

>COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PRK15347 two component system sensor kinase SsrA; Provisional	Back alignment and domain information

>COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms]	Back alignment and domain information

>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers

Back alignment and domain information

>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms]	Back alignment and domain information

>PRK11466 hybrid sensory histidine kinase TorS; Provisional	Back alignment and domain information

>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS	Back alignment and domain information

>PRK09390 fixJ response regulator FixJ; Provisional	Back alignment and domain information

>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein	Back alignment and domain information

>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional	Back alignment and domain information

>PRK12555 chemotaxis-specific methylesterase; Provisional	Back alignment and domain information

>PRK11091 aerobic respiration control sensor protein ArcB; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		613
1zgz_A		122	Torcad operon transcriptional regulatory protein;	97.42
3kht_A		144	Response regulator; PSI-II, 11023K, structural gen	97.41
3gl9_A		122	Response regulator; beta-sheet, surrounded by alph	97.4
2pl1_A		121	Transcriptional regulatory protein PHOP; CHEY-like	97.4
1p6q_A		129	CHEY2; chemotaxis, signal transduction, response r	97.4
3h1g_A		129	Chemotaxis protein CHEY homolog; sulfate-bound CHE	97.39
1jbe_A		128	Chemotaxis protein CHEY; signaling protein; 1.08A	97.39
3t6k_A		136	Response regulator receiver; flavodoxin-like, stru	97.39
2r25_B		133	Osmosensing histidine protein kinase SLN1; alpha5-	97.38
3f6p_A		120	Transcriptional regulatory protein YYCF; unphospho	97.35
2qzj_A		136	Two-component response regulator; 11017X, PSI-II,	97.31
3kto_A		136	Response regulator receiver protein; PSI-II,struct	97.3
1xhf_A		123	DYE resistance, aerobic respiration control protei	97.28
1zh2_A		121	KDP operon transcriptional regulatory protein KDPE	97.28
3hdg_A		137	Uncharacterized protein; two-component sensor acti	97.27
1dbw_A		126	Transcriptional regulatory protein FIXJ; doubly wo	97.26
2a9o_A		120	Response regulator; essential protein, YYCF/YYCG h	97.26
3crn_A		132	Response regulator receiver domain protein, CHEY-;	97.24
3lua_A		140	Response regulator receiver protein; two-component	97.23
3jte_A		143	Response regulator receiver protein; structural ge	97.23
1dz3_A		130	Stage 0 sporulation protein A; response regulator,	97.23
3b2n_A		133	Uncharacterized protein Q99UF4; structural genomic	97.22
3cfy_A		137	Putative LUXO repressor protein; structural genomi	97.2
1tmy_A		120	CHEY protein, TMY; chemotaxis, phosphoryl transfer	97.2
1dcf_A		136	ETR1 protein; beta-alpha five sandwich, transferas	97.2
1k68_A		140	Phytochrome response regulator RCPA; phosphorylate	97.19
1qo0_D		196	AMIR; binding protein, gene regulator, receptor; 2	97.15
3hv2_A		153	Response regulator/HD domain protein; PSI-2, NYSGX	97.13
3gt7_A		154	Sensor protein; structural genomics, signal receiv	97.12
1i3c_A		149	Response regulator RCP1; phytochrome, signaling pr	97.11
1k66_A		149	Phytochrome response regulator RCPB; CHEY homologu	97.1
3heb_A		152	Response regulator receiver domain protein (CHEY);	97.09
3rqi_A		184	Response regulator protein; structural genomics, s	97.09
2zay_A		147	Response regulator receiver protein; structural ge	97.08
3cnb_A		143	DNA-binding response regulator, MERR family; signa	97.07
4e7p_A		150	Response regulator; DNA binding, cytosol, transcri	97.02
2jba_A		127	Phosphate regulon transcriptional regulatory PROT;	97.02
3eod_A		130	Protein HNR; response regulator, phosphoprotein, t	97.02
3cg0_A		140	Response regulator receiver modulated diguanylate	97.0
1srr_A		124	SPO0F, sporulation response regulatory protein; as	96.99
3cu5_A		141	Two component transcriptional regulator, ARAC FAM;	96.98
1mb3_A		124	Cell division response regulator DIVK; signal tran	96.97
3r0j_A		250	Possible two component system response transcript	96.96
3hdv_A		136	Response regulator; PSI-II, structural genomics, P	96.96
3eul_A		152	Possible nitrate/nitrite response transcriptional	96.95
3grc_A		140	Sensor protein, kinase; protein structure initiati	96.9
1s8n_A		205	Putative antiterminator; RV1626, structural genomi	96.9
3m6m_D		143	Sensory/regulatory protein RPFC; RPFF, REC, enoyl-	96.89
1mvo_A		136	PHOP response regulator; phosphate regulon, transc	96.89
2qxy_A		142	Response regulator; regulation of transcription, N	96.89
2qr3_A		140	Two-component system response regulator; structura	96.88
3h5i_A		140	Response regulator/sensory box protein/ggdef domai	96.88
3f6c_A		134	Positive transcription regulator EVGA; structural	96.86
1qkk_A		155	DCTD, C4-dicarboxylate transport transcriptional r	96.86
3n53_A		140	Response regulator receiver modulated diguanylate;	96.8
1a04_A		215	Nitrate/nitrite response regulator protein NARL; s	96.8
3kcn_A		151	Adenylate cyclase homolog; SGX, PSI 2, structural	96.8
3dzd_A		368	Transcriptional regulator (NTRC family); sigma43 a	96.78
3cg4_A		142	Response regulator receiver domain protein (CHEY-;	96.74
1dc7_A		124	NTRC, nitrogen regulation protein; receiver domain	96.72
3q9s_A		249	DNA-binding response regulator; DNA binding protei	96.69
2qvg_A		143	Two component response regulator; NYSGXRC, PSI-2,	96.68
3cz5_A		153	Two-component response regulator, LUXR family; str	96.67
1p2f_A		220	Response regulator; DRRB, OMPR/PHOB, transcription	96.67
2qsj_A		154	DNA-binding response regulator, LUXR family; struc	96.66
3bre_A		358	Probable two-component response regulator; protein	96.65
2rjn_A		154	Response regulator receiver:metal-dependent phosph	96.6
3nhm_A		133	Response regulator; protein structure initiative I	96.6
3i42_A		127	Response regulator receiver domain protein (CHEY-	96.6
1kgs_A		225	DRRD, DNA binding response regulator D; DNA-bindin	96.59
1yio_A		208	Response regulatory protein; transcription regulat	96.59
2qv0_A		143	Protein MRKE; structural genomics, transcription,	96.58
2jk1_A		139	HUPR, hydrogenase transcriptional regulatory prote	96.55
2hqr_A		223	Putative transcriptional regulator; phosporylation	96.49
3lte_A		132	Response regulator; structural genomics, PSI, prot	96.49
3eq2_A		394	Probable two-component response regulator; adaptor	96.47
1w25_A		459	Stalked-cell differentiation controlling protein;	96.37
1ny5_A		387	Transcriptional regulator (NTRC family); AAA+ ATPa	96.34
3eqz_A		135	Response regulator; structural genomics, unknown f	96.34
2oqr_A		230	Sensory transduction protein REGX3; response regul	96.28
2gkg_A		127	Response regulator homolog; social motility, recei	96.2
3klo_A		225	Transcriptional regulator VPST; REC domain, HTH do	96.09
1ys7_A		233	Transcriptional regulatory protein PRRA; response	96.04
3c3w_A		225	Two component transcriptional regulatory protein;	96.02
2gwr_A		238	DNA-binding response regulator MTRA; two-component	95.66
3c3m_A		138	Response regulator receiver protein; structural ge	95.35
3sy8_A		400	ROCR; TIM barrel phosphodiesterase-A, transcriptio	95.31
3kyj_B		145	CHEY6 protein, putative histidine protein kinase;	95.28
2rdm_A		132	Response regulator receiver protein; structural ge	94.06
2lpm_A		123	Two-component response regulator; transcription re	93.76
3a10_A		116	Response regulator; phosphoacceptor, signaling pro	93.76
3luf_A		259	Two-component system response regulator/ggdef doma	93.64
3ogl_Q		21	JAZ1 incomplete degron peptide; leucine-rich repea	93.28
3t8y_A		164	CHEB, chemotaxis response regulator protein-glutam	92.76
2pln_A		137	HP1043, response regulator; signaling protein; 1.8	92.48
2j48_A		119	Two-component sensor kinase; pseudo-receiver, circ	92.29
1a2o_A		349	CHEB methylesterase; bacterial chemotaxis, adaptat	91.98
3c97_A		140	Signal transduction histidine kinase; structural g	91.06
3cwo_X		237	Beta/alpha-barrel protein based on 1THF and 1TMY;	90.42
3ogk_Q		22	JAZ1 incomplete degron peptide; leucine rich repea	90.14
1w25_A		459	Stalked-cell differentiation controlling protein;	85.55

>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1	Back alignment and structure

Probab=97.42  E-value=0.00014  Score=60.39  Aligned_cols=42  Identities=21%  Similarity=0.199  Sum_probs=38.4

Q ss_pred             CCCCchHHHHHHHHHcCCceeEeCCCCHHHHHHHHHHHHHHh
Q 007196            1 MSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRC   42 (613)
Q Consensus         1 MSs~d~~e~v~kAL~~GA~DYLvKPv~~~eLk~lwqhV~rk~   42 (613)
                      ||++.+.+.+.+|+..||.|||.||++.++|...++.++++.
T Consensus        79 ~s~~~~~~~~~~~~~~ga~~~l~Kp~~~~~l~~~i~~~~~~~  120 (122)
T 1zgz_A           79 VTGRSDRIDRIVGLEMGADDYVTKPLELRELVVRVKNLLWRI  120 (122)
T ss_dssp             EESSCCHHHHHHHHHHTCSEEEESSCCHHHHHHHHHHHHHHH
T ss_pred             EECCCChhhHHHHHHhCHHHHccCCCCHHHHHHHHHHHHHHh
Confidence            467788899999999999999999999999999999988875

PyMOL of 1zgz

>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0	Back alignment and structure

>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C	Back alignment and structure

>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A	Back alignment and structure

>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A	Back alignment and structure

>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A	Back alignment and structure

>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ...	Back alignment and structure

>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0	Back alignment and structure

>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B	Back alignment and structure

>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A	Back alignment and structure

>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile}	Back alignment and structure

>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0	Back alignment and structure

>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A	Back alignment and structure

>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A	Back alignment and structure

>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0	Back alignment and structure

>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A*	Back alignment and structure

>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A*	Back alignment and structure

>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1}	Back alignment and structure

>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum}	Back alignment and structure

>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405}	Back alignment and structure

>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A*	Back alignment and structure

>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus}	Back alignment and structure

>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y	Back alignment and structure

>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2	Back alignment and structure

>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1	Back alignment and structure

>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3	Back alignment and structure

>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5}	Back alignment and structure

>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB}	Back alignment and structure

>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A	Back alignment and structure

>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1	Back alignment and structure

>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0	Back alignment and structure

>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei}	Back alignment and structure

>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans}	Back alignment and structure

>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea}	Back alignment and structure

>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A	Back alignment and structure

>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A	Back alignment and structure

>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12}	Back alignment and structure

>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp}	Back alignment and structure

>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E	Back alignment and structure

>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg}	Back alignment and structure

>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A	Back alignment and structure

>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis}	Back alignment and structure

>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0	Back alignment and structure

>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis}	Back alignment and structure

>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP}	Back alignment and structure

>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A	Back alignment and structure

>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV}	Back alignment and structure

>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1	Back alignment and structure

>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima}	Back alignment and structure

>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis}	Back alignment and structure

>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901}	Back alignment and structure

>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12}	Back alignment and structure

>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A	Back alignment and structure

>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0	Back alignment and structure

>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A	Back alignment and structure

>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica}	Back alignment and structure

>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A	Back alignment and structure

>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1}	Back alignment and structure

>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A*	Back alignment and structure

>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans}	Back alignment and structure

>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp}	Back alignment and structure

>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP}	Back alignment and structure

>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A*	Back alignment and structure

>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3}	Back alignment and structure

>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A*	Back alignment and structure

>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis}	Back alignment and structure

>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus}	Back alignment and structure

>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0	Back alignment and structure

>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A*	Back alignment and structure

>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A	Back alignment and structure

>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae}	Back alignment and structure

>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B	Back alignment and structure

>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori}	Back alignment and structure

>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri}	Back alignment and structure

>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A	Back alignment and structure

>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A*	Back alignment and structure

>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A*	Back alignment and structure

>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0	Back alignment and structure

>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV}	Back alignment and structure

>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A	Back alignment and structure

>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A*	Back alignment and structure

>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A	Back alignment and structure

>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis}	Back alignment and structure

>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A	Back alignment and structure

>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1}	Back alignment and structure

>3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa}	Back alignment and structure

>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B*	Back alignment and structure

>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae}	Back alignment and structure

>2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti}	Back alignment and structure

>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A*	Back alignment and structure

>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A*	Back alignment and structure

>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima}	Back alignment and structure

>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A	Back alignment and structure

>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus}	Back alignment and structure

>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1	Back alignment and structure

>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40}	Back alignment and structure

>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A	Back alignment and structure

>3ogk_Q JAZ1 incomplete degron peptide; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana}	Back alignment and structure

>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		613
d1jbea_		128	c.23.1.1 (A:) CheY protein {Escherichia coli [TaxI	4e-05
d2a9pa1		117	c.23.1.1 (A:2-118) DNA-binding response regulator	4e-05
d2pl1a1		119	c.23.1.1 (A:1-119) PhoP receiver domain {Escherich	6e-05
d1zesa1		121	c.23.1.1 (A:3-123) PhoB receiver domain {Escherich	7e-05
d1k68a_		140	c.23.1.1 (A:) Response regulator for cyanobacteria	8e-05
d1dz3a_		123	c.23.1.1 (A:) Sporulation response regulator Spo0A	9e-05
d1zh2a1		119	c.23.1.1 (A:2-120) Transcriptional regulatory prot	1e-04
d1ys7a2		121	c.23.1.1 (A:7-127) Transcriptional regulatory prot	1e-04
d1zgza1		120	c.23.1.1 (A:2-121) TorCAD operon transcriptional r	1e-04
d1mb3a_		123	c.23.1.1 (A:) Cell division response regulator Div	2e-04
d1xhfa1		121	c.23.1.1 (A:2-122) Aerobic respiration control pro	2e-04
d1mvoa_		121	c.23.1.1 (A:) PhoP receiver domain {Bacillus subti	2e-04
d1k66a_		149	c.23.1.1 (A:) Response regulator for cyanobacteria	3e-04
d1dcfa_		134	c.23.1.2 (A:) Receiver domain of the ethylene rece	3e-04
d1ny5a1		137	c.23.1.1 (A:1-137) Transcriptional activator sigm5	5e-04
d1p6qa_		129	c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti	5e-04
d1dbwa_		123	c.23.1.1 (A:) Transcriptional regulatory protein F	6e-04
d1p2fa2		120	c.23.1.1 (A:1-120) Response regulator DrrB {Thermo	6e-04
d1krwa_		123	c.23.1.1 (A:) NTRC receiver domain {Salmonella typ	6e-04
d2r25b1		128	c.23.1.1 (B:1087-1214) Response regulator Sin1 {Ba	7e-04
d1yioa2		128	c.23.1.1 (A:3-130) Response regulatory protein Sty	8e-04
d2ayxa1		133	c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C	8e-04
d1u0sy_		118	c.23.1.1 (Y:) CheY protein {Thermotoga maritima [T	8e-04
d1i3ca_		144	c.23.1.1 (A:) Response regulator for cyanobacteria	8e-04
d1kgsa2		122	c.23.1.1 (A:2-123) PhoB receiver domain {Thermotog	0.001
d1w25a1		139	c.23.1.1 (A:2-140) Response regulator PleD, receiv	0.002
d1a04a2		138	c.23.1.1 (A:5-142) Nitrate/nitrite response regula	0.004
d1peya_		119	c.23.1.1 (A:) Sporulation response regulator Spo0F	0.004
d1qkka_		140	c.23.1.1 (A:) Transcriptional regulatory protein D	0.004

>d1jbea_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]} Length = 128	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: CheY-like
family: CheY-related
domain: CheY protein
species: Escherichia coli [TaxId: 562]

 Score = 41.5 bits (97), Expect = 4e-05
 Identities = 6/41 (14%), Positives = 16/41 (39%)

Query: 1   MSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRR 41
           +++      +      GA  ++VKP     L+     ++ +
Sbjct: 85  VTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEK 125

PyMOL of d1jbea_

>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 117	Back information, alignment and structure

>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Length = 119	Back information, alignment and structure

>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Length = 121	Back information, alignment and structure

>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Length = 140	Back information, alignment and structure

>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Length = 123	Back information, alignment and structure

>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 119	Back information, alignment and structure

>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 121	Back information, alignment and structure

>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 120	Back information, alignment and structure

>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Length = 123	Back information, alignment and structure

>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 121	Back information, alignment and structure

>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Length = 121	Back information, alignment and structure

>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Length = 149	Back information, alignment and structure

>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 134	Back information, alignment and structure

>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 137	Back information, alignment and structure

>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Length = 129	Back information, alignment and structure

>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Length = 123	Back information, alignment and structure

>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Length = 120	Back information, alignment and structure

>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Length = 123	Back information, alignment and structure

>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 128	Back information, alignment and structure

>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Length = 128	Back information, alignment and structure

>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 133	Back information, alignment and structure

>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Length = 118	Back information, alignment and structure

>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Length = 144	Back information, alignment and structure

>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Length = 122	Back information, alignment and structure

>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 139	Back information, alignment and structure

>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Length = 138	Back information, alignment and structure

>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Length = 119	Back information, alignment and structure

>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Length = 140	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		613
d1qkka_		140	Transcriptional regulatory protein DctD, receiver	98.08
d2pl1a1		119	PhoP receiver domain {Escherichia coli [TaxId: 562	98.05
d1zh2a1		119	Transcriptional regulatory protein KdpE, N-termina	98.05
d1xhfa1		121	Aerobic respiration control protein ArcA, N-termin	98.04
d1zgza1		120	TorCAD operon transcriptional regulator TorD, N-te	98.03
d1p2fa2		120	Response regulator DrrB {Thermotoga maritima [TaxI	98.03
d1zesa1		121	PhoB receiver domain {Escherichia coli [TaxId: 562	98.02
d1ny5a1		137	Transcriptional activator sigm54 (NtrC1), N-termin	97.99
d1krwa_		123	NTRC receiver domain {Salmonella typhimurium [TaxI	97.98
d2a9pa1		117	DNA-binding response regulator MicA, N-terminal do	97.96
d1qo0d_		189	Positive regulator of the amidase operon AmiR {Pse	97.96
d1jbea_		128	CheY protein {Escherichia coli [TaxId: 562]}	97.94
d1kgsa2		122	PhoB receiver domain {Thermotoga maritima [TaxId:	97.94
d1dbwa_		123	Transcriptional regulatory protein FixJ, receiver	97.92
d1mvoa_		121	PhoP receiver domain {Bacillus subtilis [TaxId: 14	97.86
d1w25a1		139	Response regulator PleD, receiver domain {Caulobac	97.86
d1dz3a_		123	Sporulation response regulator Spo0A {Bacillus ste	97.85
d2ayxa1		133	Sensor kinase protein RcsC, C-terminal domain {Esc	97.83
d1p6qa_		129	CheY protein {Sinorhizobium meliloti, CheY2 [TaxId	97.8
d1peya_		119	Sporulation response regulator Spo0F {Bacillus sub	97.77
d1s8na_		190	Probable two-component system transcriptional regu	97.74
d1yioa2		128	Response regulatory protein StyR, N-terminal domai	97.73
d1w25a2		153	Response regulator PleD, receiver domain {Caulobac	97.73
d1ys7a2		121	Transcriptional regulatory protein PrrA, N-termina	97.71
d1i3ca_		144	Response regulator for cyanobacterial phytochrome	97.71
d1k68a_		140	Response regulator for cyanobacterial phytochrome	97.64
d2r25b1		128	Response regulator Sin1 {Baker's yeast (Saccharomy	97.64
d1k66a_		149	Response regulator for cyanobacterial phytochrome	97.63
d1a04a2		138	Nitrate/nitrite response regulator (NarL), receive	97.56
d1dcfa_		134	Receiver domain of the ethylene receptor {Thale cr	97.42
d1mb3a_		123	Cell division response regulator DivK {Caulobacter	97.4
d1a2oa1		140	Methylesterase CheB, N-terminal domain {Salmonella	95.41
d2b4aa1		118	Hypothetical protein BH3024 {Bacillus halodurans [	91.28

>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: CheY-like
family: CheY-related
domain: Transcriptional regulatory protein DctD, receiver domain
species: Sinorhizobium meliloti [TaxId: 382]

Probab=98.08  E-value=1.4e-06  Score=76.74  Aligned_cols=42  Identities=17%  Similarity=0.347  Sum_probs=39.3

Q ss_pred             CCCCchHHHHHHHHHcCCceeEeCCCCHHHHHHHHHHHHHHh
Q 007196            1 MSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRC   42 (613)
Q Consensus         1 MSs~d~~e~v~kAL~~GA~DYLvKPv~~~eLk~lwqhV~rk~   42 (613)
                      ||++++++++.+|++.||.|||+|||+.++|...+++++++.
T Consensus        78 lT~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~~~~~  119 (140)
T d1qkka_          78 VTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSARRAEEKR  119 (140)
T ss_dssp             EECGGGHHHHHHHHHTTCCEEEESSCCHHHHHHHHHHHHHHH
T ss_pred             EECCCCHHHHHHHHHcCCCEeecCCCCHHHHHHHHHHHHHHH
Confidence            689999999999999999999999999999999999987665

PyMOL of d1qkka_

>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1jbea_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]}	Back information, alignment and structure

>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]}	Back information, alignment and structure

>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]}	Back information, alignment and structure

>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]}	Back information, alignment and structure

>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]}	Back information, alignment and structure

>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]}	Back information, alignment and structure

>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]}	Back information, alignment and structure

>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]}	Back information, alignment and structure

>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure