Citrus Sinensis ID: 007200


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610---
MGKLERVVWAFLVSILFFDLLLRVASNAEGDALNALKTNLADPNNVLQSWDATLVNPCTWFHVTCNSENSVTRVDLGNANLSGQLVSQLGQLTNLQYLELYSNNISGKVPEELGNLTNLVSLDLYLNNLNGPIPTTLGKLSKLRFLRLNNNSLMGEIPRSLTNVNSLQVLDLSNNKLTGDIPTNGSFSLFTPISFANNQLNNPPPSPPPPLQPTPPGASSGNSATGAIAGGVAAGAALLFAAPAIALAYWRKRKPEDHFFDVPAEEDPEVHLGQLKRFSLRELQVATDNFSNRNILGRGGFGKVYKGRLTDGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPFMVNGSVASCLRERGQSQPPLNWSVRKQIALGAARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEQLVDSDMEGNYIEEEVEQLIQVALLCTQGSPMERPKMSEVVRMLEGDGLAERWEEWQKEEMFRQDFNHTPHPNNTWIVDSTSHIQPDELSGPR
ccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccccccccccccEEEEcccccEEEEEccccccCEEccHHHHcccccccccccccccCCcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccCCccccccccHHHHHHHHcccccccEEECcccccEEEEEcccccEEEEEEEccccccccHHHHHHHHHHHHcccccccccEEEEECcccccEEEccccccccHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccEEEcccccEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHccccccEEccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccHHHHHccccccccccccccccccccccccccccccccccc
****ERVVWAFLVSILFFDLLLRVASNAEGDALNALKTNLADPNNVLQSWDATLVNPCTWFHVTCNSENSVTRVDLGNANLSGQLVSQLGQLTNLQYLELYSNNISGKVPEELGNLTNLVSLDLYLNNLNGPIPTTLGKLSKLRFLRLNNNSLMGEIPRSLTNVNSLQVLDLSNNKLTGDIPTNGSFSLFTPISFANNQLNNP***********************AIAGGVAAGAALLFAAPAIALAYWRKRKPEDHFFDVPAE**PEVHLGQLKRFSLRELQVATDNFSNRNILGRGGFGKVYKGRLTDGSLVAVKRLKEE*TQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPFMVNGSVASCLRERGQSQPPLNWSVRKQIALGAARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEQLVDSDMEGNYIEEEVEQLIQVALLCTQGSPMERPKMSEVVRMLEGDGLAER**********************************DELS***
xxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKLERVVWAFLVSILFFDLLLRVASNAEGDALNALKTNLADPNNVLQSWDATLVNPCTWFHVTCNSENSVTRVDLGNANLSGQLVSQLGQLTNLQYLELYSNNISGKVPEELGNLTNLVSLDLYLNNLNGPIPTTLGKLSKLRFLRLNNNSLMGEIPRSLTNVNSLQVLDLSNNKLTGDIPTNGSFSLFTPISFANNQLNNPPPSPPPPLQPTPPGASSGNSATGAIAGGVAAGAALLFAAPAIALAYWRKRKPEDHFFDVPAEEDPEVHLGQLKRFSLRELQVATDNFSNRNILGRGGFGKVYKGRLTDGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPFMVNGSVASCLRERGQSQPPLNWSVRKQIALGAARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEQLVDSDMEGNYIEEEVEQLIQVALLCTQGSPMERPKMSEVVRMLEGDGLAERWEEWQKEEMFRQDFNHTPHPNNTWIVDSTSHIQPDELSGPR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 Dual specificity kinase acting on both serine/threonine-and tyrosine-containing substrates. Controls the expression of genes associated with innate immunity in the absence of pathogens or elicitors. Involved in brassinosteroid (BR) signal transduction. Phosphorylates BRI1. May be involved in changing the equilibrium between plasma membrane-located BRI1 homodimers and endocytosed BRI1-BAK1 heterodimers. Interaction with MSBP1 stimulates the endocytosis of BAK1 and suppresses brassinosteroid signaling. Acts in pathogen-associated molecular pattern (PAMP)-triggered immunity (PTI) via its interaction with FLS2 and the phosphorylation of BIK1. Involved in programmed cell death (PCD) control. Positively regulates the BR-dependent plant growth pathway and negatively regulates the BR-independent cell-death pathway.confidentQ94F62
Somatic embryogenesis receptor kinase 5 Serine/threonine-kinase of unknown function.probableQ8LPS5
Somatic embryogenesis receptor kinase 1 Dual specificity kinase acting on both serine/threonine-and tyrosine-containing substrates. Phosphorylates BRI1 on 'Ser-887' and CDC48 on at least one threonine residue and on 'Ser-41'. Confers embryogenic competence. Acts redundantly with SERK2 as a control point for sporophytic development controlling male gametophyte production. Involved in the brassinolide signaling pathway.probableQ94AG2

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.10.-Protein-tyrosine kinases.probable
2.7.10.1Transferred entry: 2.7.10.1 and 2.7.10.2.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 24-204
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 273-574
View the alignment between query and template
View the model in PyMOL
Template: 2KS1, chain B
Confidence level:probable
Coverage over the Query: 224-256
View the alignment between query and template
View the model in PyMOL