BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 007223
         (612 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1U35|D Chain D, Crystal Structure Of The Nucleosome Core Particle
           Containing The Histone Domain Of Macroh2a
 pdb|1U35|H Chain H, Crystal Structure Of The Nucleosome Core Particle
           Containing The Histone Domain Of Macroh2a
 pdb|2F8N|D Chain D, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a
           Nucleosomes
          Length = 126

 Score = 28.9 bits (63), Expect = 9.2,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 5/34 (14%)

Query: 162 DDGLSAR-----NLQMNDVLGRIASTAQELAHYH 190
           D G+S++     N  +ND+  RIAS A  LAHY+
Sbjct: 52  DTGISSKAMGIMNSFVNDIFERIASEASRLAHYN 85


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.132    0.378 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,730,936
Number of Sequences: 62578
Number of extensions: 577520
Number of successful extensions: 1457
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 1453
Number of HSP's gapped (non-prelim): 9
length of query: 612
length of database: 14,973,337
effective HSP length: 105
effective length of query: 507
effective length of database: 8,402,647
effective search space: 4260142029
effective search space used: 4260142029
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)