Citrus Sinensis ID: 007235
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 611 | ||||||
| 359481176 | 734 | PREDICTED: transcription factor bHLH140- | 0.913 | 0.760 | 0.667 | 0.0 | |
| 147867251 | 864 | hypothetical protein VITISV_005888 [Viti | 0.957 | 0.677 | 0.647 | 0.0 | |
| 224140455 | 718 | predicted protein [Populus trichocarpa] | 0.900 | 0.766 | 0.659 | 0.0 | |
| 255579308 | 749 | aprataxin, putative [Ricinus communis] g | 0.888 | 0.724 | 0.672 | 0.0 | |
| 357438365 | 639 | Transcription factor bHLH140, partial [M | 0.949 | 0.907 | 0.608 | 0.0 | |
| 356496191 | 734 | PREDICTED: transcription factor bHLH140- | 0.911 | 0.758 | 0.616 | 0.0 | |
| 296081123 | 678 | unnamed protein product [Vitis vinifera] | 0.831 | 0.749 | 0.609 | 0.0 | |
| 449440255 | 712 | PREDICTED: transcription factor bHLH140- | 0.878 | 0.754 | 0.614 | 0.0 | |
| 449483719 | 712 | PREDICTED: transcription factor bHLH140- | 0.878 | 0.754 | 0.614 | 0.0 | |
| 15240948 | 912 | aprataxin [Arabidopsis thaliana] gi|7533 | 0.865 | 0.580 | 0.568 | 0.0 |
| >gi|359481176|ref|XP_002270443.2| PREDICTED: transcription factor bHLH140-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 779 bits (2011), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 391/586 (66%), Positives = 459/586 (78%), Gaps = 28/586 (4%)
Query: 11 AKDEEKKWKQILVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTINKGKSGTKVQCLTS 70
+K+ E + K I+V+++GAPGSGKSTFCEHV+RSS RPW R+CQDTI GK+GTK QCL S
Sbjct: 7 SKEGEGQGKPIVVLLMGAPGSGKSTFCEHVIRSSTRPWVRVCQDTIGNGKAGTKSQCLKS 66
Query: 71 ASSALKKGKSVFLDRCNLEREQRTDFVKLGGPEVDVHAVVLDLPAKLCISRSVKRIEHEG 130
A+SAL+ GKSVF+DRCNL+REQR +FVKLG P+V++HAVVLDLPA+LCISRSVKR HEG
Sbjct: 67 ATSALEDGKSVFIDRCNLDREQRAEFVKLGSPQVEMHAVVLDLPAQLCISRSVKRTGHEG 126
Query: 131 NLQGGKAAAVVNRMLQKKELPKLSEGFSRITLCQNENDVQAALDTYSGLGPLDTLPHGSF 190
NLQGGKAAAVVNRMLQKKELPKLSEGF RIT CQN++DVQ AL+TYS L LDTLP G F
Sbjct: 127 NLQGGKAAAVVNRMLQKKELPKLSEGFHRITFCQNDSDVQTALNTYSALSHLDTLPPGCF 186
Query: 191 GQKNPDAKIQLGIMKFLKKVDAPSNTGSTASSTQDPVPPQITEEKNSCLEGQEITSLLSD 250
GQKNPDAKIQLGIMKFLKKV+ P N G SS S
Sbjct: 187 GQKNPDAKIQLGIMKFLKKVEVPVNVGEDISS--------------------------SS 220
Query: 251 AAGEEVKGTENPEVASVNQNGSSSDVPTLAFPSLSTSDFQFNNEKASDVIIEKVEEFVNK 310
+E+KG E+ V SV+ SS D+PTLAFPS+ST+DFQFN+EKA+D+I+EKVEEFVNK
Sbjct: 221 GNAKEIKGGEDIVVHSVDGTVSSKDIPTLAFPSISTADFQFNHEKAADIILEKVEEFVNK 280
Query: 311 LGNARLVLVDLTQGSKILSLVRAKAAQKHINPKKFFTFVGDITRLYTGGGLCCNVIANAA 370
+ NARLVLVDL+ GSKILSLVRAKAAQ++I+ KFFTFVGDITRLY+ GGL CN IANAA
Sbjct: 281 VENARLVLVDLSHGSKILSLVRAKAAQRNIDSNKFFTFVGDITRLYSKGGLRCNAIANAA 340
Query: 371 NWRLKPGGGGVNAAIFSAAGPALEVATAERAKSLYPGNSVIVPLPSTSPLCGREGVTHVI 430
NWRLKPGGGG NAAIFSAAGP LEV T +RA SL PG +++VPLPSTSPL REGVTHVI
Sbjct: 341 NWRLKPGGGGANAAIFSAAGPELEVETKKRAGSLIPGKALVVPLPSTSPLFSREGVTHVI 400
Query: 431 HVLGPNMNPRRPNCLDGDYVKGCEILRKAYTSLFEGFLSIVRSQEKLSKGCNEDIRLEPS 490
HVLGPNMN +RPNCL+ DYVKG ++LR+AYTSLFEGF SI+ +Q L +G +E++R E S
Sbjct: 401 HVLGPNMNRQRPNCLNNDYVKGSKVLREAYTSLFEGFASIMNTQGNLLEGSSENLRSELS 460
Query: 491 VSQDHSEDVHGNYISTGD-KIKRDGGHEYEQSKKCK-TQNEVGTDINLSRAANLSADNEK 548
VSQDH + H + D KIKR G +E E SKKCK Q+E D S+ +NEK
Sbjct: 461 VSQDHFKGNHIKNVPNHDQKIKRVGVYESETSKKCKGFQDEHEFDCTESKEGKDKLNNEK 520
Query: 549 IGVSTSKAWGSWAQALYRTAMYPERHKDDLLEISDDVVVLNDLYPK 594
IG + +K WGSWAQ+LY AM+PE+HKD+L+EISDDVVVLNDLYPK
Sbjct: 521 IGRNMTKTWGSWAQSLYHIAMHPEKHKDNLIEISDDVVVLNDLYPK 566
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147867251|emb|CAN83280.1| hypothetical protein VITISV_005888 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224140455|ref|XP_002323598.1| predicted protein [Populus trichocarpa] gi|222868228|gb|EEF05359.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255579308|ref|XP_002530499.1| aprataxin, putative [Ricinus communis] gi|223529956|gb|EEF31883.1| aprataxin, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357438365|ref|XP_003589458.1| Transcription factor bHLH140, partial [Medicago truncatula] gi|355478506|gb|AES59709.1| Transcription factor bHLH140, partial [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356496191|ref|XP_003516953.1| PREDICTED: transcription factor bHLH140-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|296081123|emb|CBI18255.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449440255|ref|XP_004137900.1| PREDICTED: transcription factor bHLH140-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449483719|ref|XP_004156669.1| PREDICTED: transcription factor bHLH140-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|15240948|ref|NP_195751.1| aprataxin [Arabidopsis thaliana] gi|75335734|sp|Q9M041.1|BH140_ARATH RecName: Full=Transcription factor bHLH140; AltName: Full=Basic helix-loop-helix protein 140; Short=AtbHLH140; Short=bHLH 140; AltName: Full=Transcription factor EN 122; AltName: Full=bHLH transcription factor bHLH140 gi|7320709|emb|CAB81914.1| putative protein [Arabidopsis thaliana] gi|332002943|gb|AED90326.1| aprataxin [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 611 | ||||||
| TAIR|locus:2179122 | 912 | APTX "APRATAXIN-like" [Arabido | 0.405 | 0.271 | 0.648 | 5.8e-170 | |
| POMBASE|SPAC23C11.04c | 408 | pnk1 "DNA kinase/phosphatase P | 0.224 | 0.335 | 0.292 | 8.3e-07 | |
| WB|WBGene00009010 | 407 | F21D5.5 [Caenorhabditis elegan | 0.220 | 0.331 | 0.290 | 6.1e-05 | |
| UNIPROTKB|E2R0U3 | 521 | PNKP "Uncharacterized protein" | 0.212 | 0.249 | 0.290 | 0.00053 | |
| DICTYBASE|DDB_G0281229 | 544 | pnkp "putative bifunctional po | 0.116 | 0.130 | 0.384 | 0.00056 | |
| UNIPROTKB|F1RHU1 | 522 | PNKP "Uncharacterized protein" | 0.212 | 0.249 | 0.276 | 0.00088 |
| TAIR|locus:2179122 APTX "APRATAXIN-like" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 799 (286.3 bits), Expect = 5.8e-170, Sum P(3) = 5.8e-170
Identities = 164/253 (64%), Positives = 196/253 (77%)
Query: 259 TENPEVASVNQNGSSSDVPTLAFPSLSTSDFQFNNEKASDVIIEKVEEFVNKLGNARLVL 318
T N V+ V GS+ VPTLAFPS+ST+DFQF+ EKASD+I+EK EEF++KLG ARLVL
Sbjct: 439 TANVRVSPVKL-GSADIVPTLAFPSISTADFQFDLEKASDIIVEKAEEFLSKLGTARLVL 497
Query: 319 VDLTQGSKILSLVRAKAAQKHINPKKFFTFVGDITRLYTGGGLCCNVIANAANWRLKPGG 378
VDL++GSKILSLV+AKA+QK+I+ KFFTFVGDIT+L + GGL CNVIANA NWRLKPGG
Sbjct: 498 VDLSRGSKILSLVKAKASQKNIDSAKFFTFVGDITKLRSEGGLHCNVIANATNWRLKPGG 557
Query: 379 GGVNAAIFSAAGPALEVATAERAKSLYPGNSVIVPLPSTSPLCGREGVTHVIHVLGPNMN 438
GGVNAAIF AAGP LE AT RA +L PG +V+VPLPST PL EG+THVIHVLGPNMN
Sbjct: 558 GGVNAAIFKAAGPDLETATRVRANTLLPGKAVVVPLPSTCPLHNAEGITHVIHVLGPNMN 617
Query: 439 PRRPNCLDGDYVKGCEILRKAYTSLFEGFLSIVRSQEKLSKGCNEDIRLEPSVSQDHSED 498
P RP+ L+ DY KGC+ LR+AYTSLFEGFLS+V+ Q KL K ++ + S +D ED
Sbjct: 618 PNRPDNLNNDYTKGCKTLREAYTSLFEGFLSVVQDQSKLPKRSSQTA-VSDS-GEDIKED 675
Query: 499 VHGN--YISTGDK 509
N Y + DK
Sbjct: 676 SERNKKYKGSQDK 688
|
|
| POMBASE|SPAC23C11.04c pnk1 "DNA kinase/phosphatase Pnk1" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00009010 F21D5.5 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R0U3 PNKP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0281229 pnkp "putative bifunctional polynucleotide phosphatase/kinase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RHU1 PNKP "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 611 | |||
| pfam13671 | 143 | pfam13671, AAA_33, AAA domain | 2e-28 | |
| cd02908 | 165 | cd02908, Macro_Appr_pase_like, Macro domain, Appr- | 2e-11 | |
| TIGR01663 | 526 | TIGR01663, PNK-3'Pase, polynucleotide 5'-kinase 3' | 5e-10 | |
| smart00506 | 133 | smart00506, A1pp, Appr-1"-p processing enzyme | 2e-09 | |
| pfam01661 | 117 | pfam01661, Macro, Macro domain | 2e-09 | |
| COG2110 | 179 | COG2110, COG2110, Predicted phosphatase homologous | 4e-09 | |
| COG4639 | 168 | COG4639, COG4639, Predicted kinase [General functi | 1e-08 | |
| TIGR04075 | 851 | TIGR04075, bacter_Pnkp, polynucleotide kinase-phos | 3e-08 | |
| PRK00431 | 177 | PRK00431, PRK00431, RNase III inhibitor; Provision | 4e-08 | |
| cd02907 | 175 | cd02907, Macro_Af1521_BAL_like, Macro domain, Af15 | 2e-07 | |
| cd02749 | 147 | cd02749, Macro, Macro domain, a high-affinity ADP- | 3e-07 | |
| cd02903 | 137 | cd02903, Macro_BAL_like, Macro domain, BAL_like fa | 1e-06 |
| >gnl|CDD|222307 pfam13671, AAA_33, AAA domain | Back alignment and domain information |
|---|
Score = 110 bits (277), Expect = 2e-28
Identities = 45/146 (30%), Positives = 65/146 (44%), Gaps = 19/146 (13%)
Query: 22 LVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTINKGKSGTKV---------------Q 66
L++MVG PGSGKSTF ++R + DT+ K G +
Sbjct: 1 LILMVGLPGSGKSTFARRLLR--ELGAVVLSSDTLRKRLRGDGPPDISYYARASGRVYQR 58
Query: 67 CLTSASSALKKGKSVFLDRCNLEREQRTDFVKLG-GPEVDVHAVVLDLPAKLCISRSVKR 125
L A AL+ G+ V +D NL RE+R + L V V L+ P ++ R+ +R
Sbjct: 59 LLELAREALRAGRPVIVDATNLSREERARLIDLARRYGAPVRIVYLEAPEEVLRERNAQR 118
Query: 126 IEHEGNLQGGKAAAVVNRMLQKKELP 151
E G AV++RML + E P
Sbjct: 119 -ERSGGDPSDVPEAVLDRMLARFEPP 143
|
This family of domains contain only a P-loop motif, that is characteristic of the AAA superfamily. Many of the proteins in this family are just short fragments so there is no Walker B motif. Length = 143 |
| >gnl|CDD|239236 cd02908, Macro_Appr_pase_like, Macro domain, Appr-1"-pase_like family | Back alignment and domain information |
|---|
| >gnl|CDD|130724 TIGR01663, PNK-3'Pase, polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|214701 smart00506, A1pp, Appr-1"-p processing enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|216634 pfam01661, Macro, Macro domain | Back alignment and domain information |
|---|
| >gnl|CDD|225021 COG2110, COG2110, Predicted phosphatase homologous to the C-terminal domain of histone macroH2A1 [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226986 COG4639, COG4639, Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234457 TIGR04075, bacter_Pnkp, polynucleotide kinase-phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|234759 PRK00431, PRK00431, RNase III inhibitor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239235 cd02907, Macro_Af1521_BAL_like, Macro domain, Af1521- and BAL-like family | Back alignment and domain information |
|---|
| >gnl|CDD|239150 cd02749, Macro, Macro domain, a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases) | Back alignment and domain information |
|---|
| >gnl|CDD|239231 cd02903, Macro_BAL_like, Macro domain, BAL_like family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 611 | |||
| cd02904 | 186 | Macro_H2A_like Macro domain, Macro_H2A_like family | 99.95 | |
| cd02905 | 140 | Macro_GDAP2_like Macro domain, GDAP2_like family. | 99.94 | |
| PRK04143 | 264 | hypothetical protein; Provisional | 99.92 | |
| cd02906 | 147 | Macro_1 Macro domain, Unknown family 1. The macro | 99.92 | |
| cd02908 | 165 | Macro_Appr_pase_like Macro domain, Appr-1"-pase_li | 99.91 | |
| cd02907 | 175 | Macro_Af1521_BAL_like Macro domain, Af1521- and BA | 99.9 | |
| PRK00431 | 177 | RNase III inhibitor; Provisional | 99.9 | |
| cd02903 | 137 | Macro_BAL_like Macro domain, BAL_like family. The | 99.89 | |
| COG2110 | 179 | Predicted phosphatase homologous to the C-terminal | 99.86 | |
| cd03330 | 133 | Macro_2 Macro domain, Unknown family 2. The macro | 99.86 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 99.78 | |
| COG4639 | 168 | Predicted kinase [General function prediction only | 99.76 | |
| smart00506 | 133 | A1pp Appr-1"-p processing enzyme. Function determi | 99.75 | |
| cd02749 | 147 | Macro Macro domain, a high-affinity ADP-ribose bin | 99.74 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 99.73 | |
| cd02900 | 186 | Macro_Appr_pase Macro domain, Appr-1"-pase family. | 99.68 | |
| PF01661 | 118 | Macro: Macro domain; InterPro: IPR002589 The Macro | 99.64 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 99.64 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 99.6 | |
| KOG2633 | 200 | consensus Hismacro and SEC14 domain-containing pro | 99.59 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 99.58 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 99.57 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 99.57 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 99.52 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 99.51 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 99.5 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 99.49 | |
| KOG3354 | 191 | consensus Gluconate kinase [Carbohydrate transport | 99.46 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 99.41 | |
| COG3265 | 161 | GntK Gluconate kinase [Carbohydrate transport and | 99.4 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 99.39 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 99.38 | |
| cd02901 | 140 | Macro_Poa1p_like Macro domain, Poa1p_like family. | 99.37 | |
| KOG3079 | 195 | consensus Uridylate kinase/adenylate kinase [Nucle | 99.35 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 99.34 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 99.34 | |
| COG0645 | 170 | Predicted kinase [General function prediction only | 99.33 | |
| KOG2134 | 422 | consensus Polynucleotide kinase 3' phosphatase [Re | 99.33 | |
| cd02904 | 186 | Macro_H2A_like Macro domain, Macro_H2A_like family | 99.3 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 99.27 | |
| PRK04143 | 264 | hypothetical protein; Provisional | 99.25 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 99.25 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 99.25 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 99.24 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 99.22 | |
| PLN02674 | 244 | adenylate kinase | 99.22 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 99.21 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 99.21 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 99.19 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 99.18 | |
| PLN02200 | 234 | adenylate kinase family protein | 99.18 | |
| PRK11545 | 163 | gntK gluconate kinase 1; Provisional | 99.18 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 99.17 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 99.16 | |
| PRK13808 | 333 | adenylate kinase; Provisional | 99.16 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 99.15 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 99.13 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 99.13 | |
| PRK06217 | 183 | hypothetical protein; Validated | 99.12 | |
| smart00072 | 184 | GuKc Guanylate kinase homologues. Active enzymes c | 99.1 | |
| PLN02459 | 261 | probable adenylate kinase | 99.1 | |
| cd02905 | 140 | Macro_GDAP2_like Macro domain, GDAP2_like family. | 99.1 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 99.08 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 99.06 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 99.05 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 99.05 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 99.04 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 99.04 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 99.03 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 99.01 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 98.99 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 98.99 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 98.97 | |
| PF08303 | 168 | tRNA_lig_kinase: tRNA ligase kinase domain; InterP | 98.97 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 98.96 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 98.94 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 98.94 | |
| cd02908 | 165 | Macro_Appr_pase_like Macro domain, Appr-1"-pase_li | 98.94 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 98.94 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 98.94 | |
| PLN02772 | 398 | guanylate kinase | 98.93 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 98.93 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 98.92 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 98.91 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 98.91 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 98.88 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 98.87 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 98.87 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 98.87 | |
| PF01591 | 222 | 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 | 98.87 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 98.86 | |
| PF07931 | 174 | CPT: Chloramphenicol phosphotransferase-like prote | 98.86 | |
| PRK03839 | 180 | putative kinase; Provisional | 98.86 | |
| KOG3062 | 281 | consensus RNA polymerase II elongator associated p | 98.86 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 98.85 | |
| cd02906 | 147 | Macro_1 Macro domain, Unknown family 1. The macro | 98.84 | |
| KOG2134 | 422 | consensus Polynucleotide kinase 3' phosphatase [Re | 98.83 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 98.83 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 98.83 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 98.82 | |
| PLN02842 | 505 | nucleotide kinase | 98.8 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 98.79 | |
| PRK06696 | 223 | uridine kinase; Validated | 98.78 | |
| cd02907 | 175 | Macro_Af1521_BAL_like Macro domain, Af1521- and BA | 98.77 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 98.77 | |
| cd02903 | 137 | Macro_BAL_like Macro domain, BAL_like family. The | 98.77 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 98.75 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 98.75 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 98.74 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 98.73 | |
| PRK00431 | 177 | RNase III inhibitor; Provisional | 98.73 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 98.72 | |
| PRK00081 | 194 | coaE dephospho-CoA kinase; Reviewed | 98.72 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 98.68 | |
| COG2110 | 179 | Predicted phosphatase homologous to the C-terminal | 98.67 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 98.67 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 98.65 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 98.64 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 98.64 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 98.64 | |
| PRK14021 | 542 | bifunctional shikimate kinase/3-dehydroquinate syn | 98.62 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 98.62 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 98.61 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 98.6 | |
| PRK14730 | 195 | coaE dephospho-CoA kinase; Provisional | 98.59 | |
| TIGR00152 | 188 | dephospho-CoA kinase. This model produces scores i | 98.59 | |
| PHA02595 | 154 | tk.4 hypothetical protein; Provisional | 98.59 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 98.58 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 98.57 | |
| cd02022 | 179 | DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 | 98.57 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 98.56 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 98.55 | |
| PRK12338 | 319 | hypothetical protein; Provisional | 98.55 | |
| COG4185 | 187 | Uncharacterized protein conserved in bacteria [Fun | 98.55 | |
| COG3709 | 192 | Uncharacterized component of phosphonate metabolis | 98.54 | |
| PRK13973 | 213 | thymidylate kinase; Provisional | 98.51 | |
| PRK14732 | 196 | coaE dephospho-CoA kinase; Provisional | 98.5 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 98.5 | |
| PRK14731 | 208 | coaE dephospho-CoA kinase; Provisional | 98.5 | |
| PRK07667 | 193 | uridine kinase; Provisional | 98.47 | |
| PRK05416 | 288 | glmZ(sRNA)-inactivating NTPase; Provisional | 98.47 | |
| KOG4622 | 291 | consensus Predicted nucleotide kinase [General fun | 98.46 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 98.42 | |
| KOG2633 | 200 | consensus Hismacro and SEC14 domain-containing pro | 98.41 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 98.41 | |
| PRK14733 | 204 | coaE dephospho-CoA kinase; Provisional | 98.41 | |
| PLN02199 | 303 | shikimate kinase | 98.4 | |
| PTZ00451 | 244 | dephospho-CoA kinase; Provisional | 98.38 | |
| PLN02422 | 232 | dephospho-CoA kinase | 98.37 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 98.36 | |
| KOG0635 | 207 | consensus Adenosine 5'-phosphosulfate kinase [Inor | 98.35 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 98.34 | |
| cd01673 | 193 | dNK Deoxyribonucleoside kinase (dNK) catalyzes the | 98.33 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 98.31 | |
| PLN02348 | 395 | phosphoribulokinase | 98.31 | |
| PF01202 | 158 | SKI: Shikimate kinase; InterPro: IPR000623 Shikima | 98.29 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 98.29 | |
| PRK14734 | 200 | coaE dephospho-CoA kinase; Provisional | 98.27 | |
| cd02030 | 219 | NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO | 98.27 | |
| PRK12337 | 475 | 2-phosphoglycerate kinase; Provisional | 98.26 | |
| KOG0707 | 231 | consensus Guanylate kinase [Nucleotide transport a | 98.24 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 98.24 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 98.22 | |
| PRK07429 | 327 | phosphoribulokinase; Provisional | 98.18 | |
| PLN02924 | 220 | thymidylate kinase | 98.18 | |
| PF01121 | 180 | CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th | 98.12 | |
| PRK13951 | 488 | bifunctional shikimate kinase/3-dehydroquinate syn | 98.1 | |
| cd03330 | 133 | Macro_2 Macro domain, Unknown family 2. The macro | 98.07 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 98.04 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 98.03 | |
| TIGR00017 | 217 | cmk cytidylate kinase. This family consists of cyt | 98.02 | |
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 97.99 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 97.99 | |
| PRK13974 | 212 | thymidylate kinase; Provisional | 97.97 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 97.97 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 97.96 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 97.96 | |
| KOG3078 | 235 | consensus Adenylate kinase [Nucleotide transport a | 97.95 | |
| PRK07933 | 213 | thymidylate kinase; Validated | 97.93 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 97.92 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 97.91 | |
| PF03668 | 284 | ATP_bind_2: P-loop ATPase protein family; InterPro | 97.9 | |
| PF02223 | 186 | Thymidylate_kin: Thymidylate kinase; InterPro: IPR | 97.88 | |
| COG0125 | 208 | Tmk Thymidylate kinase [Nucleotide transport and m | 97.87 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 97.87 | |
| PRK03333 | 395 | coaE dephospho-CoA kinase/protein folding accessor | 97.85 | |
| COG0237 | 201 | CoaE Dephospho-CoA kinase [Coenzyme metabolism] | 97.85 | |
| cd02900 | 186 | Macro_Appr_pase Macro domain, Appr-1"-pase family. | 97.85 | |
| cd02026 | 273 | PRK Phosphoribulokinase (PRK) is an enzyme involve | 97.84 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 97.83 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 97.79 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.78 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 97.77 | |
| PF01661 | 118 | Macro: Macro domain; InterPro: IPR002589 The Macro | 97.74 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 97.73 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 97.7 | |
| COG2074 | 299 | 2-phosphoglycerate kinase [Carbohydrate transport | 97.7 | |
| KOG3877 | 393 | consensus NADH:ubiquinone oxidoreductase, NDUFA10/ | 97.64 | |
| PRK00023 | 225 | cmk cytidylate kinase; Provisional | 97.58 | |
| COG0283 | 222 | Cmk Cytidylate kinase [Nucleotide transport and me | 97.56 | |
| PRK13976 | 209 | thymidylate kinase; Provisional | 97.53 | |
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 97.5 | |
| COG3896 | 205 | Chloramphenicol 3-O-phosphotransferase [Defense me | 97.48 | |
| KOG3308 | 225 | consensus Uncharacterized protein of the uridine k | 97.37 | |
| COG1660 | 286 | Predicted P-loop-containing kinase [General functi | 97.37 | |
| PRK00091 | 307 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 97.35 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 97.31 | |
| cd02749 | 147 | Macro Macro domain, a high-affinity ADP-ribose bin | 97.31 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.29 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 97.25 | |
| PRK11860 | 661 | bifunctional 3-phosphoshikimate 1-carboxyvinyltran | 97.2 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.17 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 97.16 | |
| PRK09087 | 226 | hypothetical protein; Validated | 97.14 | |
| PF01745 | 233 | IPT: Isopentenyl transferase; InterPro: IPR002648 | 97.14 | |
| KOG3220 | 225 | consensus Similar to bacterial dephospho-CoA kinas | 97.13 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 97.11 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 97.1 | |
| smart00506 | 133 | A1pp Appr-1"-p processing enzyme. Function determi | 97.09 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 97.09 | |
| KOG4238 | 627 | consensus Bifunctional ATP sulfurylase/adenosine 5 | 97.09 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 97.08 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 97.07 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 97.06 | |
| COG1072 | 283 | CoaA Panthothenate kinase [Coenzyme metabolism] | 97.04 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 97.01 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 96.96 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 96.96 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.95 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 96.94 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 96.94 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 96.93 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 96.93 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 96.9 | |
| KOG1384 | 348 | consensus tRNA delta(2)-isopentenylpyrophosphate t | 96.9 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 96.85 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 96.85 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 96.84 | |
| PRK06620 | 214 | hypothetical protein; Validated | 96.83 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 96.83 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 96.82 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 96.81 | |
| PF13173 | 128 | AAA_14: AAA domain | 96.8 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 96.8 | |
| PHA03132 | 580 | thymidine kinase; Provisional | 96.78 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 96.78 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 96.78 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 96.77 | |
| KOG0234 | 438 | consensus Fructose-6-phosphate 2-kinase/fructose-2 | 96.77 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 96.77 | |
| PLN02840 | 421 | tRNA dimethylallyltransferase | 96.76 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 96.71 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 96.69 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 96.62 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 96.62 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.6 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 96.6 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 96.6 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 96.59 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 96.59 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 96.54 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 96.51 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.5 | |
| PLN02748 | 468 | tRNA dimethylallyltransferase | 96.48 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 96.47 | |
| COG5324 | 758 | Uncharacterized conserved protein [Function unknow | 96.46 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 96.45 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 96.44 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 96.44 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 96.42 | |
| KOG0780 | 483 | consensus Signal recognition particle, subunit Srp | 96.42 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 96.41 | |
| PHA02244 | 383 | ATPase-like protein | 96.41 | |
| PF14519 | 280 | Macro_2: Macro-like domain; PDB: 1TXZ_A 1TY8_A 1NJ | 96.4 | |
| PRK08116 | 268 | hypothetical protein; Validated | 96.34 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 96.34 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 96.34 | |
| KOG2702 | 323 | consensus Predicted panthothenate kinase/uridine k | 96.27 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 96.27 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 96.27 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.27 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 96.27 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 96.26 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 96.26 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 96.25 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 96.24 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.2 | |
| cd03331 | 152 | Macro_Poa1p_like_SNF2 Macro domain, Poa1p_like fam | 96.18 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 96.17 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 96.17 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 96.16 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 96.15 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 96.15 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 96.15 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 96.14 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 96.1 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 96.1 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 96.09 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 96.09 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 96.08 | |
| cd02901 | 140 | Macro_Poa1p_like Macro domain, Poa1p_like family. | 96.06 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 96.05 | |
| PRK08727 | 233 | hypothetical protein; Validated | 96.05 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 96.05 | |
| TIGR03707 | 230 | PPK2_P_aer polyphosphate kinase 2, PA0141 family. | 96.05 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 96.04 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 96.03 | |
| KOG1533 | 290 | consensus Predicted GTPase [General function predi | 96.02 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.02 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 96.01 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 96.0 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 96.0 | |
| TIGR00174 | 287 | miaA tRNA isopentenyltransferase (miaA). Catalyzes | 96.0 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 95.98 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 95.97 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 95.96 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 95.95 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 95.94 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 95.94 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 95.93 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 95.92 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 95.91 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 95.9 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 95.89 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 95.89 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 95.89 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 95.88 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 95.88 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 95.86 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 95.85 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 95.85 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 95.82 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 95.8 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 95.78 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.75 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 95.74 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 95.71 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 95.7 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 95.69 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 95.69 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 95.69 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 95.68 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 95.65 | |
| PF05729 | 166 | NACHT: NACHT domain | 95.65 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 95.64 | |
| KOG4235 | 244 | consensus Mitochondrial thymidine kinase 2/deoxygu | 95.64 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 95.63 | |
| KOG0609 | 542 | consensus Calcium/calmodulin-dependent serine prot | 95.62 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 95.62 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 95.6 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 95.6 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 95.59 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 95.57 | |
| PRK08181 | 269 | transposase; Validated | 95.56 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 95.55 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 95.54 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 95.53 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 95.52 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 95.51 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 95.51 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 95.51 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 95.48 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 95.47 | |
| TIGR03709 | 264 | PPK2_rel_1 polyphosphate:nucleotide phosphotransfe | 95.45 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 95.44 | |
| KOG0737 | 386 | consensus AAA+-type ATPase [Posttranslational modi | 95.44 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 95.43 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 95.42 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 95.4 | |
| TIGR03708 | 493 | poly_P_AMP_trns polyphosphate:AMP phosphotransfera | 95.37 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 95.35 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.34 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 95.34 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 95.33 | |
| PF13189 | 179 | Cytidylate_kin2: Cytidylate kinase-like family; PD | 95.32 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 95.31 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 95.3 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 95.29 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 95.29 | |
| PRK06526 | 254 | transposase; Provisional | 95.28 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 95.26 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 95.25 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 95.24 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 95.23 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 95.2 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 95.19 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 95.18 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.17 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 95.16 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.14 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 95.11 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 95.1 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 95.1 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 95.1 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 95.08 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 95.08 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 95.06 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 95.06 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 95.04 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 95.03 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 95.02 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 95.02 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 95.01 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 95.01 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 95.01 | |
| COG0324 | 308 | MiaA tRNA delta(2)-isopentenylpyrophosphate transf | 95.01 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 95.0 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 95.0 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 94.99 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 94.99 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 94.99 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 94.99 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 94.96 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 94.95 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 94.95 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 94.94 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 94.93 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 94.88 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 94.88 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 94.87 | |
| COG4240 | 300 | Predicted kinase [General function prediction only | 94.83 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 94.83 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 94.82 | |
| TIGR00101 | 199 | ureG urease accessory protein UreG. This model rep | 94.81 | |
| PRK13768 | 253 | GTPase; Provisional | 94.8 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 94.8 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 94.8 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 94.77 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 94.76 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 94.76 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 94.72 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 94.72 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 94.72 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 94.69 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 94.68 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 94.64 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 94.63 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 94.63 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 94.62 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 94.61 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 94.61 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 94.58 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 94.57 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 94.56 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 94.54 | |
| PRK14729 | 300 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 94.54 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 94.54 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 94.53 | |
| COG3172 | 187 | NadR Predicted ATPase/kinase involved in NAD metab | 94.53 | |
| PF03976 | 228 | PPK2: Polyphosphate kinase 2 (PPK2); InterPro: IPR | 94.52 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 94.52 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 94.5 | |
| PRK09169 | 2316 | hypothetical protein; Validated | 94.49 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 94.48 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 94.48 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 94.45 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 94.44 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 94.43 | |
| PF13479 | 213 | AAA_24: AAA domain | 94.42 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 94.42 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 94.33 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 94.29 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 94.28 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 94.28 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 94.27 | |
| cd01918 | 149 | HprK_C HprK/P, the bifunctional histidine-containi | 94.27 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 94.25 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 94.24 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 94.23 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 94.22 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 94.17 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 94.16 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 94.14 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 94.14 | |
| PRK14490 | 369 | putative bifunctional molybdopterin-guanine dinucl | 94.13 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 94.12 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 94.11 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 94.08 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 94.07 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 94.07 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 94.05 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 94.05 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 94.04 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 94.04 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 94.03 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 94.03 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 94.03 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 94.02 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 94.02 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 94.01 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 93.98 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 93.96 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 93.96 | |
| TIGR00231 | 161 | small_GTP small GTP-binding protein domain. This m | 93.94 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 93.92 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 93.92 | |
| cd00154 | 159 | Rab Rab family. Rab GTPases form the largest famil | 93.91 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 93.9 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 93.89 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 93.89 |
| >cd02904 Macro_H2A_like Macro domain, Macro_H2A_like family | Back alignment and domain information |
|---|
Probab=99.95 E-value=2.3e-27 Score=231.03 Aligned_cols=115 Identities=19% Similarity=0.123 Sum_probs=102.6
Q ss_pred cCCeEEEEEEccc--ceecccCcccccEEEeCCCCCCcCCCChhhHHHHHhhcHHHHHHHHHhc---CCCCCCCEEEecC
Q 007235 340 INPKKFFTFVGDI--TRLYTGGGLCCNVIANAANWRLKPGGGGVNAAIFSAAGPALEVATAERA---KSLYPGNSVIVPL 414 (611)
Q Consensus 340 ~~~~~v~i~~GDI--t~~~~~~~~~~daIVN~aN~~L~~~ggGVa~aI~~aAG~~l~~e~~~~~---~~~~~G~~v~T~l 414 (611)
+.+.+|.|++||| |++. +||||||||.+|. ++|||++||+++||++|++||+++. +++++|++++|+
T Consensus 15 ~~~~~i~i~~gDI~~t~~~------vDaIVNaaN~~L~-~ggGV~~AI~~aaG~~l~~ec~~~~~~~g~~~~G~~~iT~- 86 (186)
T cd02904 15 FLGQKLSLVQSDISIGSID------VEGIVHPTNADID-LKGEVGNALEKKGGKEFVEAVKELRKSNGPLEIAGAAVSQ- 86 (186)
T ss_pred cCCCEEEEEECCcccccee------ccEEEcCCccccC-CCCcHhHHHHHHcCHHHHHHHHHHHHhcCCCCCCCEEEcc-
Confidence 4568899999999 9987 9999999999999 8999999999999999999998763 789999999998
Q ss_pred CCCCCCCCCCCccEEEEecCCCCCCCCCCCCCCCchhhHHHHHHHHHHHHHHH-----HHhhccccCCC
Q 007235 415 PSTSPLCGREGVTHVIHVLGPNMNPRRPNCLDGDYVKGCEILRKAYTSLFEGF-----LSIVRSQEKLS 478 (611)
Q Consensus 415 ~~~~~~~~~l~~k~ViH~vgP~~~~~~~~~~~~~~~~~~~~L~~ay~~~L~~a-----~siafp~~~~~ 478 (611)
+ .+|+|+||||+|||.|+.. +.+++|++||++||++| .|||||+||-+
T Consensus 87 -----a-~~Lp~k~VIHtVgP~~~~~----------~~~~~L~~~~~~~L~~A~e~~~~SIAfPaIstG 139 (186)
T cd02904 87 -----A-HGLPAKFVIHCHSPQWGSD----------KCEEQLEKTVKNCLAAAEDKKLKSIAFPSLPSG 139 (186)
T ss_pred -----C-CCCCCCEEEEeCCCCCCCC----------chHHHHHHHHHHHHHHHHHcCCCEEEECCcccC
Confidence 3 4488999999999999654 23689999999999997 59999999943
|
The macro domain is a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases). Some macro domains recognize poly ADP-ribose as a ligand. Previously identified as displaying an Appr-1"-p (ADP-ribose-1"-monophosphate) processing activity, the macro domain may play roles in distinct ADP-ribose pathways, such as the ADP-ribosylation of proteins, an important post-translational modification which occurs in DNA repair, transcription, chromatin biology, and long-term memory formation, among other processes. Members of this family are similar to macroH2A, a variant of the major-type core histone H2A, which contains an N-terminal H2A domain and a C-terminal nonhistone macro domain. Histone macroH2A is enriched on the inactive X chromosome of mammalian female cells. It does not bind poly ADP-r |
| >cd02905 Macro_GDAP2_like Macro domain, GDAP2_like family | Back alignment and domain information |
|---|
| >PRK04143 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02906 Macro_1 Macro domain, Unknown family 1 | Back alignment and domain information |
|---|
| >cd02908 Macro_Appr_pase_like Macro domain, Appr-1"-pase_like family | Back alignment and domain information |
|---|
| >cd02907 Macro_Af1521_BAL_like Macro domain, Af1521- and BAL-like family | Back alignment and domain information |
|---|
| >PRK00431 RNase III inhibitor; Provisional | Back alignment and domain information |
|---|
| >cd02903 Macro_BAL_like Macro domain, BAL_like family | Back alignment and domain information |
|---|
| >COG2110 Predicted phosphatase homologous to the C-terminal domain of histone macroH2A1 [General function prediction only] | Back alignment and domain information |
|---|
| >cd03330 Macro_2 Macro domain, Unknown family 2 | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >COG4639 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >smart00506 A1pp Appr-1"-p processing enzyme | Back alignment and domain information |
|---|
| >cd02749 Macro Macro domain, a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases) | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >cd02900 Macro_Appr_pase Macro domain, Appr-1"-pase family | Back alignment and domain information |
|---|
| >PF01661 Macro: Macro domain; InterPro: IPR002589 The Macro or A1pp domain is a module of about 180 amino acids which can bind ADP-ribose, an NAD metabolite or related ligands | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2633 consensus Hismacro and SEC14 domain-containing proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02901 Macro_Poa1p_like Macro domain, Poa1p_like family | Back alignment and domain information |
|---|
| >KOG3079 consensus Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0645 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd02904 Macro_H2A_like Macro domain, Macro_H2A_like family | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04143 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PRK11545 gntK gluconate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK13808 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >smart00072 GuKc Guanylate kinase homologues | Back alignment and domain information |
|---|
| >PLN02459 probable adenylate kinase | Back alignment and domain information |
|---|
| >cd02905 Macro_GDAP2_like Macro domain, GDAP2_like family | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02908 Macro_Appr_pase_like Macro domain, Appr-1"-pase_like family | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02772 guanylate kinase | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02906 Macro_1 Macro domain, Unknown family 1 | Back alignment and domain information |
|---|
| >KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02842 nucleotide kinase | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >cd02907 Macro_Af1521_BAL_like Macro domain, Af1521- and BAL-like family | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd02903 Macro_BAL_like Macro domain, BAL_like family | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00431 RNase III inhibitor; Provisional | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00081 coaE dephospho-CoA kinase; Reviewed | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >COG2110 Predicted phosphatase homologous to the C-terminal domain of histone macroH2A1 [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14730 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00152 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PHA02595 tk | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PRK12338 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4185 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13973 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14732 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PRK14731 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional | Back alignment and domain information |
|---|
| >KOG4622 consensus Predicted nucleotide kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >KOG2633 consensus Hismacro and SEC14 domain-containing proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >PRK14733 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02199 shikimate kinase | Back alignment and domain information |
|---|
| >PTZ00451 dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02422 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK14734 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) | Back alignment and domain information |
|---|
| >PRK12337 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0707 consensus Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK07429 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PLN02924 thymidylate kinase | Back alignment and domain information |
|---|
| >PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 | Back alignment and domain information |
|---|
| >PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
|---|
| >cd03330 Macro_2 Macro domain, Unknown family 2 | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00017 cmk cytidylate kinase | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK13974 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3078 consensus Adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07933 thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins | Back alignment and domain information |
|---|
| >PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 | Back alignment and domain information |
|---|
| >COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd02900 Macro_Appr_pase Macro domain, Appr-1"-pase family | Back alignment and domain information |
|---|
| >cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PF01661 Macro: Macro domain; InterPro: IPR002589 The Macro or A1pp domain is a module of about 180 amino acids which can bind ADP-ribose, an NAD metabolite or related ligands | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3877 consensus NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK00023 cmk cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13976 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG3896 Chloramphenicol 3-O-phosphotransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG1660 Predicted P-loop-containing kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >cd02749 Macro Macro domain, a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases) | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] | Back alignment and domain information |
|---|
| >KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >smart00506 A1pp Appr-1"-p processing enzyme | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >KOG4238 consensus Bifunctional ATP sulfurylase/adenosine 5'-phosphosulfate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >KOG1384 consensus tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PHA03132 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0234 consensus Fructose-6-phosphate 2-kinase/fructose-2,6-biphosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PLN02840 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PLN02748 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >COG5324 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PF14519 Macro_2: Macro-like domain; PDB: 1TXZ_A 1TY8_A 1NJR_A | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >KOG2702 consensus Predicted panthothenate kinase/uridine kinase-related protein [Nucleotide transport and metabolism; Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >cd03331 Macro_Poa1p_like_SNF2 Macro domain, Poa1p_like family, SNF2 subfamily | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd02901 Macro_Poa1p_like Macro domain, Poa1p_like family | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR03707 PPK2_P_aer polyphosphate kinase 2, PA0141 family | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >KOG1533 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00174 miaA tRNA isopentenyltransferase (miaA) | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >KOG4235 consensus Mitochondrial thymidine kinase 2/deoxyguanosine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0609 consensus Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >TIGR03709 PPK2_rel_1 polyphosphate:nucleotide phosphotransferase, PPK2 family | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >TIGR03708 poly_P_AMP_trns polyphosphate:AMP phosphotransferase | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG4240 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >TIGR00101 ureG urease accessory protein UreG | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF03976 PPK2: Polyphosphate kinase 2 (PPK2); InterPro: IPR022488 This presumed domain is found in one or two copies per protein | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK09169 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >TIGR00231 small_GTP small GTP-binding protein domain | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >cd00154 Rab Rab family | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 611 | ||||
| 3zvn_A | 416 | The Structural Basis For Substrate Recognition By M | 3e-06 | ||
| 3zvl_A | 416 | The Structural Basis For Substrate Recognition By M | 3e-06 | ||
| 3u7e_B | 381 | Crystal Structure Of Mpnkp Catalytic Fragment (D170 | 5e-06 | ||
| 3zvm_A | 416 | The Structural Basis For Substrate Recognition By M | 6e-06 | ||
| 1yj5_A | 383 | Molecular Architecture Of Mammalian Polynucleotide | 8e-06 | ||
| 3u7g_A | 379 | Crystal Structure Of Mpnkp Catalytic Fragment (D170 | 9e-06 | ||
| 4gp6_A | 171 | Polynucleotide Kinase Length = 171 | 5e-04 | ||
| 1spv_A | 184 | Crystal Structure Of The Putative Phosphatase Of Es | 9e-04 |
| >pdb|3ZVN|A Chain A, The Structural Basis For Substrate Recognition By Mammalian Polynucleotide Kinase 3' Phosphatase Length = 416 | Back alignment and structure |
|
| >pdb|3ZVL|A Chain A, The Structural Basis For Substrate Recognition By Mammalian Polynucleotide Kinase 3' Phosphatase Length = 416 | Back alignment and structure |
| >pdb|3U7E|B Chain B, Crystal Structure Of Mpnkp Catalytic Fragment (D170a) Length = 381 | Back alignment and structure |
| >pdb|3ZVM|A Chain A, The Structural Basis For Substrate Recognition By Mammalian Polynucleotide Kinase 3' Phosphatase Length = 416 | Back alignment and structure |
| >pdb|1YJ5|A Chain A, Molecular Architecture Of Mammalian Polynucleotide Kinase, A Dna Repair Enzyme Length = 383 | Back alignment and structure |
| >pdb|3U7G|A Chain A, Crystal Structure Of Mpnkp Catalytic Fragment (D170a) Bound To Single- Stranded Dna (Tcctap) Length = 379 | Back alignment and structure |
| >pdb|4GP6|A Chain A, Polynucleotide Kinase Length = 171 | Back alignment and structure |
| >pdb|1SPV|A Chain A, Crystal Structure Of The Putative Phosphatase Of Escherichia Coli, Northeast Structural Genomoics Target Er58 Length = 184 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 611 | |||
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 1e-22 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 8e-21 | |
| 3ejf_A | 176 | Non-structural protein 3; IBV, coronavirus, X-doma | 9e-19 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 7e-17 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 4e-16 | |
| 3ejg_A | 193 | Non-structural protein 3; HCOV 229E, X-domain, mac | 5e-16 | |
| 3gqe_A | 168 | Non-structural protein 3; macro domain, X domain, | 7e-16 | |
| 2vri_A | 174 | Non-structural protein 3; RNA replication, nucleot | 1e-15 | |
| 3q71_A | 221 | Poly [ADP-ribose] polymerase 14; structural genomi | 1e-15 | |
| 1vhu_A | 211 | Hypothetical protein AF1521; structural genomics, | 3e-15 | |
| 3eti_A | 168 | X (ADRP) domain, macro domain of non-structural pr | 1e-13 | |
| 1spv_A | 184 | Putative polyprotein/phosphatase; structural genom | 1e-13 | |
| 2acf_A | 182 | Replicase polyprotein 1AB; ADRP domain, SARS NSP-3 | 2e-13 | |
| 3gpg_A | 168 | NSP3, non-structural protein 3; macro domain, X do | 3e-13 | |
| 3q6z_A | 214 | Poly [ADP-ribose] polymerase 14; structural genomi | 3e-13 | |
| 2dx6_A | 159 | Hypothetical protein TTHA0132; conserved hypotheti | 3e-13 | |
| 3kh6_A | 199 | Poly [ADP-ribose] polymerase 15; macro, PARP, BAL3 | 1e-12 | |
| 2xd7_A | 193 | Core histone macro-H2A.2; chromosomal protein, nuc | 2e-12 | |
| 1yd9_A | 193 | Core histone macro-H2A.1; alpha-beta structure, A1 | 4e-12 | |
| 2x47_A | 235 | Macro domain-containing protein 1; signaling prote | 7e-12 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 8e-10 | |
| 1njr_A | 284 | 32.1 kDa protein in ADH3-RCA1 intergenic region; s | 3e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-08 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 1e-07 | |
| 3sp4_A | 204 | Aprataxin-like protein; HIT domain, zinc finger, D | 1e-05 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 2e-05 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 8e-05 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 1e-04 |
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Length = 416 | Back alignment and structure |
|---|
Score = 99.6 bits (247), Expect = 1e-22
Identities = 35/146 (23%), Positives = 63/146 (43%), Gaps = 9/146 (6%)
Query: 19 KQILVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTINKGKSGTKVQCLTSASSALKKG 78
+V+ VG PG+GKSTF + + S + + +DT+ G+ +C++S +AL++G
Sbjct: 257 NPEVVVAVGFPGAGKSTFIQEHLVS--AGYVHVNRDTL-----GSWQRCVSSCQAALRQG 309
Query: 79 KSVFLDRCNLEREQRTDFVKLG-GPEVDVHAVVLDLPAKLCISRSVKRIEHEGNLQGGKA 137
K V +D N + R +++ V + + R E +
Sbjct: 310 KRVVIDNTNPDVPSRARYIQCAKDAGVPCRCFNFCATIEQARHNNRFR-EMTDPSHAPVS 368
Query: 138 AAVVNRMLQKKELPKLSEGFSRITLC 163
V+ ++ E P L+EGF I
Sbjct: 369 DMVMFSYRKQFEPPTLAEGFLEILEI 394
|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Length = 181 | Back alignment and structure |
|---|
| >3ejf_A Non-structural protein 3; IBV, coronavirus, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting; 1.60A {Avian infectious bronchitis virus} PDB: 3eke_A* 3ewo_A 3ewp_A* Length = 176 | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Length = 301 | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Length = 260 | Back alignment and structure |
|---|
| >3ejg_A Non-structural protein 3; HCOV 229E, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting, RNA-binding; 1.78A {Human coronavirus 229E} PDB: 3ewr_A* 3ewq_A* Length = 193 | Back alignment and structure |
|---|
| >3gqe_A Non-structural protein 3; macro domain, X domain, venezuelan equine encephalitis virus alphavirus; HET: BCN; 2.30A {Venezuelan equine encephalitis virus} PDB: 3gqo_A* Length = 168 | Back alignment and structure |
|---|
| >2vri_A Non-structural protein 3; RNA replication, nucleotide-binding, endonuclease, macro domain, viral protein, ATP-binding, exonuclease; 1.8A {Human coronavirus NL63} Length = 174 | Back alignment and structure |
|---|
| >3q71_A Poly [ADP-ribose] polymerase 14; structural genomics, structural genomics consortium, SGC, transferase, PARP14 macro 2; HET: AR6; 2.20A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >1vhu_A Hypothetical protein AF1521; structural genomics, unknown function; HET: MSE MES; 1.34A {Archaeoglobus fulgidus} SCOP: c.50.1.2 PDB: 2bfq_A* 1hjz_A* 2bfr_A* Length = 211 | Back alignment and structure |
|---|
| >3eti_A X (ADRP) domain, macro domain of non-structural protein 3; coronavirus, X domain, RNA binding protein; 2.20A {Feline infectious peritonitis virus} PDB: 3ew5_A* 3jzt_A* Length = 168 | Back alignment and structure |
|---|
| >1spv_A Putative polyprotein/phosphatase; structural genomoics, alpha/beta monomeric protein, structural genomics, PSI, protein structure initiative; HET: MES; 2.00A {Escherichia coli} SCOP: c.50.1.2 Length = 184 | Back alignment and structure |
|---|
| >2acf_A Replicase polyprotein 1AB; ADRP domain, SARS NSP-3, APPR-1-P phosphatase, structural GE joint center for structural genomics, JCSG; 1.40A {Sars coronavirus TOR2} SCOP: c.50.1.2 PDB: 2fav_A* Length = 182 | Back alignment and structure |
|---|
| >3gpg_A NSP3, non-structural protein 3; macro domain, X domain, alphavirus, VIZI enzymes involved in replication, ATP-binding, cell membrane endosome; 1.65A {Chikungunya virus} PDB: 3gpo_A* 3gpq_A Length = 168 | Back alignment and structure |
|---|
| >3q6z_A Poly [ADP-ribose] polymerase 14; structural genomics consortium, SGC, ADP-ribose binding, TRA; HET: APR; 2.23A {Homo sapiens} Length = 214 | Back alignment and structure |
|---|
| >2dx6_A Hypothetical protein TTHA0132; conserved hypothetical protein, structural genomics, NPPSFA; 1.78A {Thermus thermophilus} PDB: 3v45_A Length = 159 | Back alignment and structure |
|---|
| >2xd7_A Core histone macro-H2A.2; chromosomal protein, nucleosome core, chromatin regulator, nucleus, DNA-binding protein, phosphoprotein; 2.09A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >1yd9_A Core histone macro-H2A.1; alpha-beta structure, A1PP domain, macro-domain, structural protein; 1.60A {Rattus norvegicus} SCOP: c.50.1.2 PDB: 1zr3_A* 2fxk_A 3iid_A* 3iif_A* 1zr5_A Length = 193 | Back alignment and structure |
|---|
| >2x47_A Macro domain-containing protein 1; signaling protein, signal transduction, estrogen signaling; 1.70A {Homo sapiens} Length = 235 | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 | Back alignment and structure |
|---|
| >1njr_A 32.1 kDa protein in ADH3-RCA1 intergenic region; structural genomics, dimer, two domain organization, PSI, PR structure initiative; HET: XYL; 1.90A {Saccharomyces cerevisiae} SCOP: c.50.1.2 PDB: 1txz_A* 1ty8_A* Length = 284 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Length = 191 | Back alignment and structure |
|---|
| >3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Length = 204 | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Length = 189 | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Length = 253 | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Length = 178 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 611 | |||
| 3eti_A | 168 | X (ADRP) domain, macro domain of non-structural pr | 99.94 | |
| 3q71_A | 221 | Poly [ADP-ribose] polymerase 14; structural genomi | 99.94 | |
| 3q6z_A | 214 | Poly [ADP-ribose] polymerase 14; structural genomi | 99.93 | |
| 1spv_A | 184 | Putative polyprotein/phosphatase; structural genom | 99.93 | |
| 1yd9_A | 193 | Core histone macro-H2A.1; alpha-beta structure, A1 | 99.93 | |
| 2xd7_A | 193 | Core histone macro-H2A.2; chromosomal protein, nuc | 99.93 | |
| 4abl_A | 183 | Poly [ADP-ribose] polymerase 14; transferase, PARP | 99.92 | |
| 2x47_A | 235 | Macro domain-containing protein 1; signaling prote | 99.92 | |
| 3ejg_A | 193 | Non-structural protein 3; HCOV 229E, X-domain, mac | 99.91 | |
| 2dx6_A | 159 | Hypothetical protein TTHA0132; conserved hypotheti | 99.9 | |
| 3kh6_A | 199 | Poly [ADP-ribose] polymerase 15; macro, PARP, BAL3 | 99.9 | |
| 3gqe_A | 168 | Non-structural protein 3; macro domain, X domain, | 99.89 | |
| 2acf_A | 182 | Replicase polyprotein 1AB; ADRP domain, SARS NSP-3 | 99.89 | |
| 3gpg_A | 168 | NSP3, non-structural protein 3; macro domain, X do | 99.89 | |
| 2vri_A | 174 | Non-structural protein 3; RNA replication, nucleot | 99.89 | |
| 1vhu_A | 211 | Hypothetical protein AF1521; structural genomics, | 99.89 | |
| 3ejf_A | 176 | Non-structural protein 3; IBV, coronavirus, X-doma | 99.89 | |
| 1njr_A | 284 | 32.1 kDa protein in ADH3-RCA1 intergenic region; s | 99.86 | |
| 4gua_A | 670 | Non-structural polyprotein; viral precursor polypr | 99.84 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 99.71 | |
| 2jyc_A | 160 | Uncharacterized protein C6ORF130; macro domain, A1 | 99.68 | |
| 2eee_A | 149 | Uncharacterized protein C6ORF130; macro domain, A1 | 99.68 | |
| 2fg1_A | 158 | Conserved hypothetical protein BT1257; structural | 99.64 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 99.64 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 99.52 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 99.51 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 99.46 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 99.44 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 99.42 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 99.4 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 99.39 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 99.37 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 99.36 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 99.35 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 99.35 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 99.31 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 99.31 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 99.3 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 99.29 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 99.29 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 99.27 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 99.27 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 99.27 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 99.25 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 99.25 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 99.25 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 99.24 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 99.23 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 99.22 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 99.21 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 99.21 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 99.2 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 99.18 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 99.16 | |
| 3q71_A | 221 | Poly [ADP-ribose] polymerase 14; structural genomi | 99.16 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 99.13 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 99.07 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 99.06 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 99.05 | |
| 3q6z_A | 214 | Poly [ADP-ribose] polymerase 14; structural genomi | 99.03 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 99.02 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 99.02 | |
| 1spv_A | 184 | Putative polyprotein/phosphatase; structural genom | 99.02 | |
| 2xd7_A | 193 | Core histone macro-H2A.2; chromosomal protein, nuc | 99.01 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 99.0 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 99.0 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 98.99 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 98.99 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 98.99 | |
| 1yd9_A | 193 | Core histone macro-H2A.1; alpha-beta structure, A1 | 98.98 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 98.96 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 98.94 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 98.94 | |
| 4abl_A | 183 | Poly [ADP-ribose] polymerase 14; transferase, PARP | 98.94 | |
| 2x47_A | 235 | Macro domain-containing protein 1; signaling prote | 98.92 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 98.89 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 98.89 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 98.88 | |
| 3kh6_A | 199 | Poly [ADP-ribose] polymerase 15; macro, PARP, BAL3 | 98.87 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 98.86 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 98.86 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 98.86 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 98.85 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 98.84 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 98.8 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 98.79 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 98.79 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 98.79 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 98.79 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 98.78 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 98.78 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 98.78 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 98.75 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 98.72 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 98.72 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 98.7 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 98.7 | |
| 2dx6_A | 159 | Hypothetical protein TTHA0132; conserved hypotheti | 98.7 | |
| 3ejf_A | 176 | Non-structural protein 3; IBV, coronavirus, X-doma | 98.69 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 98.68 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 98.68 | |
| 3gpg_A | 168 | NSP3, non-structural protein 3; macro domain, X do | 98.67 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 98.66 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 98.66 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 98.64 | |
| 1vhu_A | 211 | Hypothetical protein AF1521; structural genomics, | 98.63 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 98.62 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 98.61 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 98.61 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 98.6 | |
| 2acf_A | 182 | Replicase polyprotein 1AB; ADRP domain, SARS NSP-3 | 98.6 | |
| 3gqe_A | 168 | Non-structural protein 3; macro domain, X domain, | 98.58 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 98.58 | |
| 3eti_A | 168 | X (ADRP) domain, macro domain of non-structural pr | 98.58 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 98.57 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 98.57 | |
| 1njr_A | 284 | 32.1 kDa protein in ADH3-RCA1 intergenic region; s | 98.56 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 98.56 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 98.55 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 98.55 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 98.53 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 98.53 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 98.48 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 98.47 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 98.47 | |
| 4i1u_A | 210 | Dephospho-COA kinase; structural genomics, niaid, | 98.47 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 98.46 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 98.46 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 98.45 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 98.42 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 98.38 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 98.37 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 98.36 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 98.36 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 98.35 | |
| 4gua_A | 670 | Non-structural polyprotein; viral precursor polypr | 98.34 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 98.3 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 98.3 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 98.3 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 98.3 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 98.25 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 98.25 | |
| 3ejg_A | 193 | Non-structural protein 3; HCOV 229E, X-domain, mac | 98.24 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 98.22 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 98.2 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 98.17 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 98.14 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 98.11 | |
| 3tvt_A | 292 | Disks large 1 tumor suppressor protein; DLG, SRC-h | 98.08 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 98.08 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 98.08 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 98.04 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 98.02 | |
| 3kfv_A | 308 | Tight junction protein ZO-3; structural genomics c | 98.02 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 97.94 | |
| 1kjw_A | 295 | Postsynaptic density protein 95; protein-protein i | 97.93 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 97.9 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 97.86 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 97.84 | |
| 2vri_A | 174 | Non-structural protein 3; RNA replication, nucleot | 97.83 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 97.81 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 97.75 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 97.73 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 97.72 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 97.66 | |
| 2eee_A | 149 | Uncharacterized protein C6ORF130; macro domain, A1 | 97.66 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 97.65 | |
| 2jyc_A | 160 | Uncharacterized protein C6ORF130; macro domain, A1 | 97.64 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 97.59 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 97.56 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 97.55 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 97.55 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 97.53 | |
| 4dey_A | 337 | Voltage-dependent L-type calcium channel subunit; | 97.5 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 97.5 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 97.5 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 97.49 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 97.48 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 97.48 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 97.41 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 97.4 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 97.39 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 97.21 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 97.2 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 97.17 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 97.17 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 97.15 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 97.14 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 97.09 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 96.96 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 96.95 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.95 | |
| 1p6x_A | 334 | Thymidine kinase; P-loop, LID, transferase; HET: T | 96.9 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 96.89 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 96.88 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 96.85 | |
| 3ch4_B | 202 | Pmkase, phosphomevalonate kinase; parallel beta-sh | 96.84 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 96.83 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 96.78 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.78 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 96.73 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 96.69 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 96.63 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 96.62 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.59 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 96.58 | |
| 2fg1_A | 158 | Conserved hypothetical protein BT1257; structural | 96.56 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 96.56 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 96.52 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 96.51 | |
| 3czq_A | 304 | Putative polyphosphate kinase 2; structural genomi | 96.49 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 96.48 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 96.46 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 96.46 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 96.43 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 96.42 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.36 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 96.33 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 96.33 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 96.32 | |
| 1of1_A | 376 | Thymidine kinase; transferase, antiviral drug, enz | 96.3 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 96.28 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 96.23 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 96.23 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 96.17 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 96.17 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 96.13 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 96.13 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 96.13 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 96.08 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 96.05 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 96.04 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 95.99 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 95.98 | |
| 1e2k_A | 331 | Thymidine kinase; transferase, antiviral drug, enz | 95.93 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 95.93 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 95.92 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 95.91 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 95.88 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 95.84 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 95.84 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 95.83 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 95.83 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 95.82 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 95.82 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 95.78 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 95.76 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 95.74 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 95.68 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 95.64 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 95.6 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 95.6 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 95.58 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 95.54 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 95.52 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 95.49 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 95.49 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 95.47 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 95.46 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 95.45 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 95.45 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 95.38 | |
| 3rhf_A | 289 | Putative polyphosphate kinase 2 family protein; PS | 95.32 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 95.25 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 95.24 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 95.2 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 95.17 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 95.15 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 95.14 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 95.12 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 95.1 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 95.09 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.05 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 95.01 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 95.0 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 95.0 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 95.0 | |
| 1osn_A | 341 | Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, tra | 94.98 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 94.93 | |
| 3czp_A | 500 | Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 | 94.92 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 94.9 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 94.83 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 94.81 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 94.8 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 94.8 | |
| 3sig_A | 277 | PArg, poly(ADP-ribose) glycohydrolase; HET: AR6; 1 | 94.78 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 94.73 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 94.68 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 94.66 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 94.63 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 94.54 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 94.5 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 94.49 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.44 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 94.43 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 94.42 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 94.39 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 94.35 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 94.31 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 94.3 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 94.3 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 94.28 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 94.28 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 94.22 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 94.18 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 94.18 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 94.17 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 94.17 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 94.17 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 94.14 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 94.11 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 94.08 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 94.07 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 94.06 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 93.98 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 93.97 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 93.93 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 93.92 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 93.91 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 93.9 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 93.9 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 93.86 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 93.75 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 93.74 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 93.73 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 93.72 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 93.71 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 93.71 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 93.7 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 93.7 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 93.69 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 93.69 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 93.65 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 93.63 | |
| 1dek_A | 241 | Deoxynucleoside monophosphate kinase; transferase, | 93.59 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 93.57 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 93.56 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 93.54 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 93.5 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 93.47 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 93.43 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 93.41 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 93.41 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 93.4 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 93.39 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 93.39 | |
| 3czp_A | 500 | Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 | 93.39 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 93.38 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 93.38 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 93.37 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 93.35 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 93.31 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 93.28 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 93.26 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 93.19 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 93.17 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 93.15 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 93.15 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 93.14 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 93.13 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 93.11 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 93.1 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 93.1 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 93.09 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 93.08 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 93.06 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 93.04 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 93.0 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 92.98 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 92.96 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 92.93 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 92.93 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 92.93 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 92.93 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 92.89 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 92.88 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 92.86 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 92.84 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 92.82 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 92.77 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 92.76 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 92.75 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 92.74 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 92.74 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 92.73 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 92.73 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 92.67 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 92.65 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 92.64 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 92.63 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 92.6 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 92.58 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 92.58 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 92.58 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 92.57 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 92.57 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 92.56 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 92.54 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 92.54 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 92.52 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 92.51 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 92.5 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 92.48 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 92.47 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 92.43 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 92.41 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 92.41 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 92.39 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 92.39 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 92.38 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 92.38 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 92.34 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 92.33 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 92.33 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 92.3 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 92.23 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 92.23 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 92.22 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 92.21 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 92.19 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 92.18 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 92.17 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 92.17 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 92.17 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 92.16 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 92.14 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 92.14 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 91.98 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 91.91 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 91.91 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 91.9 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 91.9 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 91.89 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 91.88 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 91.87 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 91.87 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 91.84 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 91.84 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 91.81 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 91.78 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 91.76 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 91.76 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 91.75 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 91.7 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 91.68 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 91.67 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 91.59 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 91.56 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 91.55 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 91.54 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 91.51 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 91.5 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 91.48 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 91.48 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 91.46 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 91.46 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 91.42 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 91.42 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 91.39 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 91.39 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 91.32 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 91.32 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 91.3 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 91.29 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 91.28 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 91.28 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 91.26 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 91.21 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 91.19 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 91.18 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 91.13 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 91.12 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 91.11 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 91.1 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 91.02 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 90.99 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 90.93 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 90.93 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 90.92 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 90.89 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 90.86 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 90.84 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 90.81 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 90.74 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 90.73 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 90.71 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 90.67 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 90.66 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 90.61 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 90.58 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 90.57 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 90.57 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 90.53 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 90.48 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 90.4 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 90.24 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 90.18 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 90.16 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 90.15 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 90.13 |
| >3eti_A X (ADRP) domain, macro domain of non-structural protein 3; coronavirus, X domain, RNA binding protein; 2.20A {Feline infectious peritonitis virus} PDB: 3ew5_A* 3jzt_A* | Back alignment and structure |
|---|
Probab=99.94 E-value=1.6e-27 Score=228.01 Aligned_cols=110 Identities=26% Similarity=0.282 Sum_probs=99.4
Q ss_pred eEEEEEEcccce----ecccCcccccEEEeCCCCCCcCCCChhhHHHHHhhcHHHHHHHHHhc---CCCCCCCEEEecCC
Q 007235 343 KKFFTFVGDITR----LYTGGGLCCNVIANAANWRLKPGGGGVNAAIFSAAGPALEVATAERA---KSLYPGNSVIVPLP 415 (611)
Q Consensus 343 ~~v~i~~GDIt~----~~~~~~~~~daIVN~aN~~L~~~ggGVa~aI~~aAG~~l~~e~~~~~---~~~~~G~~v~T~l~ 415 (611)
.+|.+++||||+ +. +||||||||+.|. +||||++||+++|||+|++||+++. +++++|++++|+
T Consensus 10 ~~i~l~~GDIt~~~~~~~------vDaIVNaAN~~l~-~ggGV~~AI~~aaG~~l~~ec~~~~~~~g~~~~G~a~iT~-- 80 (168)
T 3eti_A 10 GKVSFYQGDLDVLINFLE------PDVLVNAANGDLR-HVGGVARAIDVFTGGKLTKRSKEYLKSSKAIAPGNAVLFE-- 80 (168)
T ss_dssp TTEEEEESCHHHHHHHHC------CSEEEEEECTTCC-CCSTTHHHHHHHTTTHHHHHHHHHHTTSCCCCTTEEEEEE--
T ss_pred CeEEEEeCcccccCCCCC------CCEEEeCCCcccC-CCchHHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCEEEec--
Confidence 468999999999 66 9999999999999 8999999999999999999999873 789999999998
Q ss_pred CCCCCCCCCCccEEEEecCCCCCCCCCCCCCCCchhhHHHHHHHHHHHHHHHHHhhccccCC
Q 007235 416 STSPLCGREGVTHVIHVLGPNMNPRRPNCLDGDYVKGCEILRKAYTSLFEGFLSIVRSQEKL 477 (611)
Q Consensus 416 ~~~~~~~~l~~k~ViH~vgP~~~~~~~~~~~~~~~~~~~~L~~ay~~~L~~a~siafp~~~~ 477 (611)
+| ++++||||+|||.|+.. ...++|++||+++|+.+.|||||+||-
T Consensus 81 ----g~--l~~~~VIHtVgP~~~~~----------~~~~~L~~~y~~~L~~~~SIAfP~Ist 126 (168)
T 3eti_A 81 ----NV--LEHLSVMNAVGPRNGDS----------RVEGKLCNVYKAIAKCDGKILTPLISV 126 (168)
T ss_dssp ----EE--ETTEEEEEEECCCTTST----------THHHHHHHHHHHHHTSCSCEEECCTTB
T ss_pred ----CC--CCccEEEEecCCCCCcc----------hHHHHHHHHHHHHHHhcCceeeccccc
Confidence 34 67799999999999642 347899999999999989999999993
|
| >3q71_A Poly [ADP-ribose] polymerase 14; structural genomics, structural genomics consortium, SGC, transferase, PARP14 macro 2; HET: AR6; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3q6z_A Poly [ADP-ribose] polymerase 14; structural genomics consortium, SGC, ADP-ribose binding, TRA; HET: APR; 2.23A {Homo sapiens} | Back alignment and structure |
|---|
| >1spv_A Putative polyprotein/phosphatase; structural genomoics, alpha/beta monomeric protein, structural genomics, PSI, protein structure initiative; HET: MES; 2.00A {Escherichia coli} SCOP: c.50.1.2 | Back alignment and structure |
|---|
| >1yd9_A Core histone macro-H2A.1; alpha-beta structure, A1PP domain, macro-domain, structural protein; 1.60A {Rattus norvegicus} SCOP: c.50.1.2 PDB: 1zr3_A* 2fxk_A 3iid_A* 3iif_A* 1zr5_A | Back alignment and structure |
|---|
| >2xd7_A Core histone macro-H2A.2; chromosomal protein, nucleosome core, chromatin regulator, nucleus, DNA-binding protein, phosphoprotein; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >4abl_A Poly [ADP-ribose] polymerase 14; transferase, PARP14; 1.15A {Homo sapiens} PDB: 4abk_A | Back alignment and structure |
|---|
| >2x47_A Macro domain-containing protein 1; signaling protein, signal transduction, estrogen signaling; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3ejg_A Non-structural protein 3; HCOV 229E, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting, RNA-binding; 1.78A {Human coronavirus 229E} PDB: 3ewr_A* 3ewq_A* | Back alignment and structure |
|---|
| >2dx6_A Hypothetical protein TTHA0132; conserved hypothetical protein, structural genomics, NPPSFA; 1.78A {Thermus thermophilus} PDB: 3v45_A | Back alignment and structure |
|---|
| >3gqe_A Non-structural protein 3; macro domain, X domain, venezuelan equine encephalitis virus alphavirus; HET: BCN; 2.30A {Venezuelan equine encephalitis virus} PDB: 3gqo_A* | Back alignment and structure |
|---|
| >2acf_A Replicase polyprotein 1AB; ADRP domain, SARS NSP-3, APPR-1-P phosphatase, structural GE joint center for structural genomics, JCSG; 1.40A {Sars coronavirus TOR2} SCOP: c.50.1.2 PDB: 2fav_A* | Back alignment and structure |
|---|
| >3gpg_A NSP3, non-structural protein 3; macro domain, X domain, alphavirus, VIZI enzymes involved in replication, ATP-binding, cell membrane endosome; 1.65A {Chikungunya virus} PDB: 3gpo_A* 3gpq_A | Back alignment and structure |
|---|
| >2vri_A Non-structural protein 3; RNA replication, nucleotide-binding, endonuclease, macro domain, viral protein, ATP-binding, exonuclease; 1.8A {Human coronavirus NL63} | Back alignment and structure |
|---|
| >1vhu_A Hypothetical protein AF1521; structural genomics, unknown function; HET: MSE MES; 1.34A {Archaeoglobus fulgidus} SCOP: c.50.1.2 PDB: 2bfq_A* 1hjz_A* 2bfr_A* | Back alignment and structure |
|---|
| >3ejf_A Non-structural protein 3; IBV, coronavirus, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting; 1.60A {Avian infectious bronchitis virus} PDB: 3eke_A* 3ewo_A 3ewp_A* | Back alignment and structure |
|---|
| >1njr_A 32.1 kDa protein in ADH3-RCA1 intergenic region; structural genomics, dimer, two domain organization, PSI, PR structure initiative; HET: XYL; 1.90A {Saccharomyces cerevisiae} SCOP: c.50.1.2 PDB: 1txz_A* 1ty8_A* | Back alignment and structure |
|---|
| >4gua_A Non-structural polyprotein; viral precursor polyprotein, protease, zinc-binding, hydrola; HET: MES; 2.85A {Sindbis virus} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >2eee_A Uncharacterized protein C6ORF130; macro domain, A1PP domain, ADP-ribose binding, rossmann fold, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l8r_A* | Back alignment and structure |
|---|
| >2fg1_A Conserved hypothetical protein BT1257; structural genomics, PSI, PROT structure initiative; HET: MSE; 1.25A {Bacteroides thetaiotaomicron} SCOP: c.50.1.2 PDB: 2afc_A | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >3q71_A Poly [ADP-ribose] polymerase 14; structural genomics, structural genomics consortium, SGC, transferase, PARP14 macro 2; HET: AR6; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >3q6z_A Poly [ADP-ribose] polymerase 14; structural genomics consortium, SGC, ADP-ribose binding, TRA; HET: APR; 2.23A {Homo sapiens} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1spv_A Putative polyprotein/phosphatase; structural genomoics, alpha/beta monomeric protein, structural genomics, PSI, protein structure initiative; HET: MES; 2.00A {Escherichia coli} SCOP: c.50.1.2 | Back alignment and structure |
|---|
| >2xd7_A Core histone macro-H2A.2; chromosomal protein, nucleosome core, chromatin regulator, nucleus, DNA-binding protein, phosphoprotein; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1yd9_A Core histone macro-H2A.1; alpha-beta structure, A1PP domain, macro-domain, structural protein; 1.60A {Rattus norvegicus} SCOP: c.50.1.2 PDB: 1zr3_A* 2fxk_A 3iid_A* 3iif_A* 1zr5_A | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4abl_A Poly [ADP-ribose] polymerase 14; transferase, PARP14; 1.15A {Homo sapiens} PDB: 4abk_A | Back alignment and structure |
|---|
| >2x47_A Macro domain-containing protein 1; signaling protein, signal transduction, estrogen signaling; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2dx6_A Hypothetical protein TTHA0132; conserved hypothetical protein, structural genomics, NPPSFA; 1.78A {Thermus thermophilus} PDB: 3v45_A | Back alignment and structure |
|---|
| >3ejf_A Non-structural protein 3; IBV, coronavirus, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting; 1.60A {Avian infectious bronchitis virus} PDB: 3eke_A* 3ewo_A 3ewp_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >3gpg_A NSP3, non-structural protein 3; macro domain, X domain, alphavirus, VIZI enzymes involved in replication, ATP-binding, cell membrane endosome; 1.65A {Chikungunya virus} PDB: 3gpo_A* 3gpq_A | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1vhu_A Hypothetical protein AF1521; structural genomics, unknown function; HET: MSE MES; 1.34A {Archaeoglobus fulgidus} SCOP: c.50.1.2 PDB: 2bfq_A* 1hjz_A* 2bfr_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2acf_A Replicase polyprotein 1AB; ADRP domain, SARS NSP-3, APPR-1-P phosphatase, structural GE joint center for structural genomics, JCSG; 1.40A {Sars coronavirus TOR2} SCOP: c.50.1.2 PDB: 2fav_A* | Back alignment and structure |
|---|
| >3gqe_A Non-structural protein 3; macro domain, X domain, venezuelan equine encephalitis virus alphavirus; HET: BCN; 2.30A {Venezuelan equine encephalitis virus} PDB: 3gqo_A* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3eti_A X (ADRP) domain, macro domain of non-structural protein 3; coronavirus, X domain, RNA binding protein; 2.20A {Feline infectious peritonitis virus} PDB: 3ew5_A* 3jzt_A* | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1njr_A 32.1 kDa protein in ADH3-RCA1 intergenic region; structural genomics, dimer, two domain organization, PSI, PR structure initiative; HET: XYL; 1.90A {Saccharomyces cerevisiae} SCOP: c.50.1.2 PDB: 1txz_A* 1ty8_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >4gua_A Non-structural polyprotein; viral precursor polyprotein, protease, zinc-binding, hydrola; HET: MES; 2.85A {Sindbis virus} | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ejg_A Non-structural protein 3; HCOV 229E, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting, RNA-binding; 1.78A {Human coronavirus 229E} PDB: 3ewr_A* 3ewq_A* | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2vri_A Non-structural protein 3; RNA replication, nucleotide-binding, endonuclease, macro domain, viral protein, ATP-binding, exonuclease; 1.8A {Human coronavirus NL63} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >2eee_A Uncharacterized protein C6ORF130; macro domain, A1PP domain, ADP-ribose binding, rossmann fold, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l8r_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >2fg1_A Conserved hypothetical protein BT1257; structural genomics, PSI, PROT structure initiative; HET: MSE; 1.25A {Bacteroides thetaiotaomicron} SCOP: c.50.1.2 PDB: 2afc_A | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3czq_A Putative polyphosphate kinase 2; structural genomics, APC6299, PSI-2, structure initiative; HET: MSE GOL; 2.23A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ... | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3rhf_A Putative polyphosphate kinase 2 family protein; PSI-biology, MCSG, structural genomics, midwest center for S genomics; HET: PGE FLC PG4; 2.45A {Arthrobacter aurescens} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >1osn_A Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, transferase; HET: BVP ADP; 3.20A {Human herpesvirus 3} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3sig_A PArg, poly(ADP-ribose) glycohydrolase; HET: AR6; 1.28A {Thermomonospora curvata} PDB: 3sih_A 3sii_A* 3sij_A | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 611 | ||||
| d1yj5a2 | 172 | c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p | 7e-17 | |
| d1vhua_ | 192 | c.50.1.2 (A:) Hypothetical protein AF1521 {Archaeo | 2e-09 | |
| d2acfa1 | 168 | c.50.1.2 (A:184-351) Replicase polyprotein 1ab {SA | 6e-09 | |
| d1njra_ | 264 | c.50.1.2 (A:) Hypothetical protein Ymr087W {Baker' | 1e-08 | |
| d1ly1a_ | 152 | c.37.1.1 (A:) Polynucleotide kinase, kinase domain | 7e-07 | |
| d1yd9a1 | 188 | c.50.1.2 (A:6-193) Histone macro-H2a1.1 {Rat (Ratt | 1e-06 | |
| d1spva_ | 172 | c.50.1.2 (A:) Hypothetical protein YmbD {Escherich | 3e-06 | |
| d1qhxa_ | 178 | c.37.1.3 (A:) Chloramphenicol phosphotransferase { | 3e-04 | |
| d1zp6a1 | 176 | c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { | 5e-04 | |
| d2fg1a1 | 154 | c.50.1.2 (A:2-155) Hypothetical protein BT1257 {Ba | 0.002 |
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nucleotide and nucleoside kinases domain: 5' polynucleotide kinase-3' phosphatase, C-terminal domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 76.4 bits (187), Expect = 7e-17
Identities = 33/143 (23%), Positives = 61/143 (42%), Gaps = 9/143 (6%)
Query: 22 LVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTINKGKSGTKVQCLTSASSALKKGKSV 81
+V+ VG PG+GKSTF + + + + + +DT+ +C++S +AL++GK V
Sbjct: 16 VVVAVGFPGAGKSTFIQEHLV--SAGYVHVNRDTLGS-----WQRCVSSCQAALRQGKRV 68
Query: 82 FLDRCNLEREQRTDFVKLG-GPEVDVHAVVLDLPAKLCISRSVKRIEHEGNLQGGKAAAV 140
+D N + R +++ V + + R E + V
Sbjct: 69 VIDNTNPDVPSRARYIQCAKDAGVPCRCFNFCATIEQARHNNRFR-EMTDPSHAPVSDMV 127
Query: 141 VNRMLQKKELPKLSEGFSRITLC 163
+ ++ E P L+EGF I
Sbjct: 128 MFSYRKQFEPPTLAEGFLEILEI 150
|
| >d1vhua_ c.50.1.2 (A:) Hypothetical protein AF1521 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 192 | Back information, alignment and structure |
|---|
| >d2acfa1 c.50.1.2 (A:184-351) Replicase polyprotein 1ab {SARS coronavirus [TaxId: 227859]} Length = 168 | Back information, alignment and structure |
|---|
| >d1njra_ c.50.1.2 (A:) Hypothetical protein Ymr087W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 264 | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 | Back information, alignment and structure |
|---|
| >d1yd9a1 c.50.1.2 (A:6-193) Histone macro-H2a1.1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 188 | Back information, alignment and structure |
|---|
| >d1spva_ c.50.1.2 (A:) Hypothetical protein YmbD {Escherichia coli [TaxId: 562]} Length = 172 | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 | Back information, alignment and structure |
|---|
| >d2fg1a1 c.50.1.2 (A:2-155) Hypothetical protein BT1257 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 154 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 611 | |||
| d1yd9a1 | 188 | Histone macro-H2a1.1 {Rat (Rattus norvegicus) [Tax | 99.9 | |
| d1spva_ | 172 | Hypothetical protein YmbD {Escherichia coli [TaxId | 99.89 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 99.89 | |
| d1vhua_ | 192 | Hypothetical protein AF1521 {Archaeon Archaeoglobu | 99.88 | |
| d2acfa1 | 168 | Replicase polyprotein 1ab {SARS coronavirus [TaxId | 99.83 | |
| d1njra_ | 264 | Hypothetical protein Ymr087W {Baker's yeast (Sacch | 99.66 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 99.66 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 99.59 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 99.5 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 99.45 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 99.38 | |
| d2fg1a1 | 154 | Hypothetical protein BT1257 {Bacteroides thetaiota | 99.37 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 99.3 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 99.29 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 99.25 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 99.22 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 99.2 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 99.18 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 99.17 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 99.17 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 99.15 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 99.15 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 99.1 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 99.09 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 99.02 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 99.01 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 99.01 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 99.01 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 98.99 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 98.98 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 98.97 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 98.95 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 98.94 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 98.91 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 98.91 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 98.88 | |
| d1yd9a1 | 188 | Histone macro-H2a1.1 {Rat (Rattus norvegicus) [Tax | 98.84 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 98.73 | |
| d1spva_ | 172 | Hypothetical protein YmbD {Escherichia coli [TaxId | 98.72 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 98.7 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 98.66 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 98.66 | |
| d1vhua_ | 192 | Hypothetical protein AF1521 {Archaeon Archaeoglobu | 98.64 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 98.62 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 98.59 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 98.52 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 98.49 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 98.48 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 98.38 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 98.38 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 98.34 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 98.3 | |
| d1njra_ | 264 | Hypothetical protein Ymr087W {Baker's yeast (Sacch | 98.26 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 98.23 | |
| d2acfa1 | 168 | Replicase polyprotein 1ab {SARS coronavirus [TaxId | 98.09 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 98.05 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 97.98 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 97.98 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 97.95 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 97.94 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 97.87 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 97.78 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 97.77 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 97.74 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 97.68 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 97.47 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 97.44 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 97.41 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 97.4 | |
| d1kjwa2 | 199 | Guanylate kinase-like domain of Psd-95 {Rat (Rattu | 97.4 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 97.35 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 97.3 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 97.3 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 97.23 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.14 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 97.13 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 97.12 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 97.06 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 97.05 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 97.0 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.93 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 96.91 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 96.91 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 96.9 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 96.83 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 96.73 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.72 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 96.54 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.46 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 96.43 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 96.41 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 96.34 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 96.31 | |
| d2fg1a1 | 154 | Hypothetical protein BT1257 {Bacteroides thetaiota | 96.31 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 96.27 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.26 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 96.01 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 95.99 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 95.94 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 95.84 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 95.84 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 95.66 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 95.63 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 95.54 | |
| d2axpa1 | 164 | Hypothetical protein YorR {Bacillus subtilis [TaxI | 95.5 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 95.48 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 95.45 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 95.37 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 95.19 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 95.09 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 95.08 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 94.88 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 94.86 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 94.86 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 94.61 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 94.54 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 94.53 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 94.49 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 94.32 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 94.29 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 94.29 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 94.28 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 94.16 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 94.16 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 94.16 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 94.13 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 94.07 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 94.05 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 94.04 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 94.04 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 94.01 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 94.0 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 93.9 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 93.87 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 93.86 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 93.85 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 93.81 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 93.79 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 93.76 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 93.67 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 93.63 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 93.61 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 93.58 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 93.55 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 93.53 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 93.53 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 93.49 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 93.48 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 93.43 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 93.4 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 93.36 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 93.29 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 93.25 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 93.21 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 93.2 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 93.18 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 93.11 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 93.1 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 92.99 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 92.95 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 92.9 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 92.87 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 92.86 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 92.81 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 92.74 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 92.68 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 92.67 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 92.6 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 92.58 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 92.56 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 92.55 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 92.47 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 92.43 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 92.43 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 92.39 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 92.37 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 92.17 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 92.12 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 92.11 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 91.99 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 91.91 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 91.85 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 91.83 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 91.81 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 91.78 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 91.76 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 91.75 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 91.75 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 91.72 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 91.63 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 91.59 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 91.58 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 91.52 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 91.47 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 91.43 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 91.41 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 91.32 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 91.31 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 91.27 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 91.25 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 91.22 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 91.07 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 91.01 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 90.99 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 90.98 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 90.92 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 90.89 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 90.89 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 90.88 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 90.68 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 90.59 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 90.56 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 90.53 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 90.53 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 90.48 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 90.41 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 90.24 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 90.15 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 90.11 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 90.0 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 89.91 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 89.89 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 89.61 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 89.54 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 89.54 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 89.53 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 89.33 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 89.29 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 89.07 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 88.94 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 88.93 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 88.59 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 88.04 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 87.93 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 87.9 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 87.89 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 87.72 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 87.47 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 86.99 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 86.7 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 86.29 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 85.0 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 84.6 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 84.34 | |
| d1c9ka_ | 180 | Adenosylcobinamide kinase/adenosylcobinamide phosp | 84.01 | |
| d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 82.24 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 82.19 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 81.45 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 81.41 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 81.07 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 80.93 |
| >d1yd9a1 c.50.1.2 (A:6-193) Histone macro-H2a1.1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Macro domain-like superfamily: Macro domain-like family: Macro domain domain: Histone macro-H2a1.1 species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.90 E-value=7.4e-24 Score=203.93 Aligned_cols=115 Identities=18% Similarity=0.128 Sum_probs=102.9
Q ss_pred hcCCeEEEEEEcccceecccCcccccEEEeCCCCCCcCCCChhhHHHHHhhcHHHHHHHHHh---cCCCCCCCEEEecCC
Q 007235 339 HINPKKFFTFVGDITRLYTGGGLCCNVIANAANWRLKPGGGGVNAAIFSAAGPALEVATAER---AKSLYPGNSVIVPLP 415 (611)
Q Consensus 339 ~~~~~~v~i~~GDIt~~~~~~~~~~daIVN~aN~~L~~~ggGVa~aI~~aAG~~l~~e~~~~---~~~~~~G~~v~T~l~ 415 (611)
.+.+.+|.|++|||+++. +||||||||..|. ++||+++||+++||++|++||+++ .+++.+|++++|+
T Consensus 10 ~~~~~~i~i~~GDIt~~~------~DaIVn~an~~l~-~~~gv~~ai~~~~G~~l~~e~~~~~~~~~~~~~g~~~vT~-- 80 (188)
T d1yd9a1 10 LFLGQKLQVVQADIASID------SDAVVHPTNTDFY-IGGEVGSTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSA-- 80 (188)
T ss_dssp CTTSCEEEEECSCGGGCC------CSEEEEECCTTCC-CCSHHHHHHHHHHHHHHHHHHHHHHHHHCSCCTTCEEEEE--
T ss_pred cccCCEEEEEeCCcCcCC------CCEEEECCCccCC-CCchHHHHHHHHHHHHHHHHHHHHHHhccccCCCCeeecc--
Confidence 467889999999999998 9999999999999 899999999999999999999875 3678999999998
Q ss_pred CCCCCCCCCCccEEEEecCCCCCCCCCCCCCCCchhhHHHHHHHHHHHHHHH-----HHhhccccCC
Q 007235 416 STSPLCGREGVTHVIHVLGPNMNPRRPNCLDGDYVKGCEILRKAYTSLFEGF-----LSIVRSQEKL 477 (611)
Q Consensus 416 ~~~~~~~~l~~k~ViH~vgP~~~~~~~~~~~~~~~~~~~~L~~ay~~~L~~a-----~siafp~~~~ 477 (611)
+ +.|+|++|||+|||.|+.. ...++|++||++||+.| .|||||+||-
T Consensus 81 ----~-~~L~~k~IiH~v~P~~~~~----------~~~~~L~~~~~~~L~~a~~~~~~SIafP~igt 132 (188)
T d1yd9a1 81 ----G-HGLPAKFVIHCNSPVWGSD----------KCEELLEKTVKNCLALADDRKLKSIAFPSIGS 132 (188)
T ss_dssp ----C-TTSSSSEEEEECCCCTTST----------THHHHHHHHHHHHHHHHHHTTCSEEEECCCSB
T ss_pred ----c-CCCCceEEeeeccccCCCc----------chHHHHHHHHHHHHHHHHHcCCCeEEeccccC
Confidence 2 4488999999999999754 24689999999999986 4999999993
|
| >d1spva_ c.50.1.2 (A:) Hypothetical protein YmbD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vhua_ c.50.1.2 (A:) Hypothetical protein AF1521 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2acfa1 c.50.1.2 (A:184-351) Replicase polyprotein 1ab {SARS coronavirus [TaxId: 227859]} | Back information, alignment and structure |
|---|
| >d1njra_ c.50.1.2 (A:) Hypothetical protein Ymr087W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2fg1a1 c.50.1.2 (A:2-155) Hypothetical protein BT1257 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1yd9a1 c.50.1.2 (A:6-193) Histone macro-H2a1.1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1spva_ c.50.1.2 (A:) Hypothetical protein YmbD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vhua_ c.50.1.2 (A:) Hypothetical protein AF1521 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1njra_ c.50.1.2 (A:) Hypothetical protein Ymr087W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2acfa1 c.50.1.2 (A:184-351) Replicase polyprotein 1ab {SARS coronavirus [TaxId: 227859]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fg1a1 c.50.1.2 (A:2-155) Hypothetical protein BT1257 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|