Citrus Sinensis ID: 007295

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------61

MTTTSFLSPTQRYAAGALFAIALHQAQNNQTRPLGLPSEDDSNMERSSSSSSSDSVAEDPKLWVHENSGLLRPVFRFLDIDSAAWSGLEETAGCFPAKHHIGAFLRLLSEEAGDGSAQSSDQEFALSKAVDATAVSLEADSETSKSKKEKHREYENECREKCSTGKKQSHSDLENADRKTQQETDSNLAGTEDSPHESGSKFDERPIEEEAVLSYQRKVTVLYELLSACLADIPQHDKKCTRQRTGYDSRHRVALRLLATWLDIKWIKMEAVEMMVASSAMAVRKAEASKEEEATSSESKWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGASGFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAVEILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVLKTLLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRARYVC

ccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHccccccccHHHHccccccccccccccccccccccccHHHHHHccccccccccccccHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHcccHHHccccccccccccccccccccccccHHHHHHcccccHHHccHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHcccccccHHHHHHHHHHcccccEEEEEEcccccccEEEEEEEEcccccccccccccccccccccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcHHHHHHHHHHHHHHHcccccccccEEEEEcccccccHHHHHHHHHccccEEEEEEccccHHHHHHHHHcccc

ccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEccccccccEEEEEcccccHcccHHHHcccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHcHHHHHHHHcccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHcccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccEEEEEEccccccccEEEEEEEEEcccccccccccccccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHHHccccccEEEEEEEcccccccHHHHHHHHHHHccEEEEEcccccEEEHHHHHHHccc

mtttsflsptQRYAAGALFAIALHQAqnnqtrplglpseddsnmersssssssdsvaedpklwvhensgllrpvfrflDIDSaawsgleetagcfpakhHIGAFLRLLSeeagdgsaqssDQEFALSKavdatavsleadsetsksKKEKHREYENECrekcstgkkqshsdlenadrktqqetdsnlagtedsphesgskfderpieEEAVLSYQRKVTVLYELLSACLadipqhdkkctrqrtgydsRHRVALRLLATWLDIKWIKMEAVEMMVASSAMAVRKAEASkeeeatsseskwakwkrggiigaaaltggTLMAITGGLAAPAIAAGFSalaptlgtlipvigaSGFAAAASAAGTVAGSVAVAASfgaagagltgskmarrigsvdefefkaigenqnqGRLAVEILISgvvfdqedfvrpwegqndnmERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVLKTLLAALAWPATLVFAADLidskwtiavdRSDKAGKLLAEVLMQGlqgyrpvtligYSLGARVIFKCLENLAENECNAGIVERVVLLgapisikdQNWEAVRKMVAGRFIncyatndwTLAIAFRARYVC

mtttsflsptQRYAAGALFAIALHQAQNNQTRPLGLPSEDDSNMERSssssssdsvaedpKLWVHENSGLLRPVFRFLDIDSAAWSGLEETAGCFPAKHHIGAFLRLLSEEAGDGSAQSSDQEFALSKAVDatavsleadsetskskkekhreyenecrekcstgkkqshsdlenadrktqqetdsnlagtedsphesgskfderpiEEEAVLSYQRKVTVLYELLSACladipqhdkkctrqrtgydsrhrVALRLLATWLDIKWIKMEAVEMMVASSAMAVRKAEAskeeeatsseskwakwkrGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGASGFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAVEILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVLKTLLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINcyatndwtlAIAFRARYVC

MTTTSFLSPTQRYAAGALFAIALHQAQNNQTRPLGLPseddsnmersssssssdsvaedPKLWVHENSGLLRPVFRFLDIDSAAWSGLEETAGCFPAKHHIGAFLRLLSEEAGDGSAQSSDQEFALSKAVDATAVSLEADSETSKSKKEKHREYENECREKCSTGKKQSHSDLENADRKTQQETDSNLAGTEDSPHESGSKFDERPIEEEAVLSYQRKVTVLYELLSACLADIPQHDKKCTRQRTGYDSRHRVALRLLATWLDIKWIKmeavemmvassamavRkaeaskeeeatsseskwakWKRggiigaaaltggtlmaitgglaaPAIAAGFSALAPTLGTLIPVIgasgfaaaasaagtvagsvavaasfgaagagltgsKMARRIGSVDEFEFKAIGENQNQGRLAVEILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVlktllaalawpatlVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRARYVC

***********RYAAGALFAIALH*************************************LWVHENSGLLRPVFRFLDIDSAAWSGLEETAGCFPAKHHIGAFLRLL******************************************************************************************************AVLSYQRKVTVLYELLSACLADIPQHDKKCTRQRTGYDSRHRVALRLLATWLDIKWIKMEAVEMMVA***********************WAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGASGFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAVEILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVLKTLLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRARYV*

*****FLSPTQRYAAGALFAIALHQAQN**************************************NSGLLRPVFRFLDIDSAAWS********************************************************************************************************************************YQRKVTVLYELLSACLADIPQHDKKCTRQRTGYDSRHRVALRLLATWLDIKWIKMEAVEMMVAS******************************IIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGASGFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAVEILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVLKTLLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRARYVC

********PTQRYAAGALFAIALHQAQNNQTRPLGL***********************PKLWVHENSGLLRPVFRFLDIDSAAWSGLEETAGCFPAKHHIGAFLRLLSE*************FALSKAVDA***********************************************************************ERPIEEEAVLSYQRKVTVLYELLSACLADIPQHDKKCTRQRTGYDSRHRVALRLLATWLDIKWIKMEAVEMMVAS***********************AKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGASGFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAVEILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVLKTLLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRARYVC

*****FLSPTQRYAAGALFAIALHQAQNNQTRPL*************************PKLWVHENSGLLRPVFRFLDIDSAAWSGLEETAGCFPAKHHIGAFLRLLSEEA***SAQSSDQEFALSKAVDATAVSLEA*******************R**************************************************EAVLSYQRKVTVLYELLSACLADIPQHDKKCTRQRTGYDSRHRVALRLLATWLDIKWIKMEAVEMMVASSAMAVRKAEASKEEEATSSESKWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGASGFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAVEILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVLKTLLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRARYVC

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		609	2.2.26 [Sep-21-2011]
Q20035		617	Uncharacterized membrane	yes	no	0.559	0.552	0.360	5e-52
Q91WU4		631	Transmembrane and coiled-	yes	no	0.413	0.399	0.416	3e-51
Q499U8		631	Transmembrane and coiled-	yes	no	0.413	0.399	0.408	4e-49
Q5TGY1		634	Transmembrane and coiled-	yes	no	0.564	0.542	0.373	9e-49
O14244		778	Uncharacterized membrane	yes	no	0.566	0.443	0.332	8e-40
P43564		1073	Uncharacterized membrane	yes	no	0.615	0.349	0.300	2e-39
Q9US10		579	Uncharacterized membrane	no	no	0.441	0.464	0.342	1e-31

>sp\|Q20035\|TMCO4_CAEEL Uncharacterized membrane protein F35D11.3 OS=Caenorhabditis elegans GN=F35D11.3 PE=3 SV=2	Back alignment and function desciption

 Score =  206 bits (523), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 131/363 (36%), Positives = 200/363 (55%), Gaps = 22/363 (6%)

Query: 246 GYDSRHRVALRLLATWLDIKWIKMEAVEMMVASSAMAVRKAEASKEEEATSSESKWAKWK 305
            YDSR+RV LR L T L + W + E VE  +AS+ +  +  E+          ++  K K
Sbjct: 157 NYDSRYRVFLRHLTTLLGVVWTEFEDVEDSLASTLLEEQFVESEHSRTVREKTARNKKIK 216

Query: 306 RGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGASGFAAAASAAGTV 365
           R  +IGAA   GG L+ +TGGLAAP +AA    L          IG      A +   T 
Sbjct: 217 RYLMIGAAGGVGGVLIGLTGGLAAPLVAASAGML----------IGG----GAVAGLATT 262

Query: 366 AGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAVEILISGVV---- 421
           AG+  +  + G AGAG TG KM +R+G+++EF  + + E  +   L+  +++SG +    
Sbjct: 263 AGAAVLGTTMGVAGAGFTGYKMKKRVGAIEEFSVETLSEGVS---LSCSLVVSGWIESDT 319

Query: 422 FDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVLKT 481
              + FV  W       E+Y L++ES  L+ +  AI+ +L S      ++Q  + T L  
Sbjct: 320 SPDQAFVHQWRHLRHTKEQYTLRYESNYLMELGNAIE-YLMSFAVSVAIQQTLLETALAG 378

Query: 482 LLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGAR 541
           L++A+AWP  L+  + ++D+ W + V R+ + G+ LAEVL+    G RP+TLIG+SLGAR
Sbjct: 379 LVSAVAWPVALMSVSSVLDNPWNVCVSRAAEVGEQLAEVLLSRSHGKRPITLIGFSLGAR 438

Query: 542 VIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAI 601
           VIF CL  +++   + GI+E V+LLGAP++   + W  V  +V+GR IN Y   DW L  
Sbjct: 439 VIFHCLLTMSKRSESVGIIEDVILLGAPVTASPKEWSKVCTVVSGRVINGYCETDWLLRF 498

Query: 602 AFR 604
            +R
Sbjct: 499 LYR 501

Caenorhabditis elegans (taxid: 6239)

>sp\|Q91WU4\|TMCO4_MOUSE Transmembrane and coiled-coil domain-containing protein 4 OS=Mus musculus GN=Tmco4 PE=2 SV=2	Back alignment and function description

>sp\|Q499U8\|TMCO4_RAT Transmembrane and coiled-coil domain-containing protein 4 OS=Rattus norvegicus GN=Tmco4 PE=2 SV=1	Back alignment and function description

>sp\|Q5TGY1\|TMCO4_HUMAN Transmembrane and coiled-coil domain-containing protein 4 OS=Homo sapiens GN=TMCO4 PE=2 SV=1	Back alignment and function description

>sp\|O14244\|YELD_SCHPO Uncharacterized membrane protein C6F6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F6.13c PE=3 SV=1	Back alignment and function description

>sp\|P43564\|YFD4_YEAST Uncharacterized membrane protein YFL034W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL034W PE=1 SV=2	Back alignment and function description

>sp\|Q9US10\|YK68_SCHPO Uncharacterized membrane protein C6F6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC607.08c PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		609
147790173		670	hypothetical protein VITISV_012480 [Viti	0.988	0.898	0.713	0.0
225431211		662	PREDICTED: transmembrane and coiled-coil	0.988	0.909	0.738	0.0
224097118		681	predicted protein [Populus trichocarpa]	0.973	0.870	0.737	0.0
449515253		673	PREDICTED: transmembrane and coiled-coil	0.981	0.888	0.719	0.0
186516803		672	uncharacterized protein [Arabidopsis tha	0.991	0.898	0.695	0.0
255586316		713	conserved hypothetical protein [Ricinus	0.986	0.842	0.702	0.0
449457502		673	PREDICTED: transmembrane and coiled-coil	0.981	0.888	0.700	0.0
357483651		717	Transmembrane and coiled-coil domain-con	0.978	0.831	0.684	0.0
356561177		676	PREDICTED: uncharacterized membrane prot	0.973	0.877	0.715	0.0
356496683		667	PREDICTED: uncharacterized membrane prot	0.983	0.898	0.699	0.0

>gi\|147790173\|emb\|CAN59788.1\| hypothetical protein VITISV_012480 [Vitis vinifera]	Back alignment and taxonomy information

 Score =  841 bits (2172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/631 (71%), Positives = 516/631 (81%), Gaps = 29/631 (4%)

Query: 4   TSFLSPTQRYAAGALFAIALHQAQNNQTRPLGLPSEDDSNMERSSSSSSSDSVAEDPKLW 63
           +SFL+PTQRYAAGAL  +AL QAQ +QTRPLG   E+D   ER SS SSSDSV+EDP+LW
Sbjct: 2   SSFLTPTQRYAAGALLGLALQQAQIHQTRPLGSSIEED---ERISSGSSSDSVSEDPQLW 58

Query: 64  VHENSGLLRPVFRFLDIDSAAWSGLEETAGCFPAKHHIGAFLRLLSEEAGDGSAQSSDQE 123
           VHENSGLLRPVF+ L I++ AW+GLEETAG  PAKHH+GAFLRL+SEE+ + SA   D E
Sbjct: 59  VHENSGLLRPVFKSLKIENKAWTGLEETAGSSPAKHHVGAFLRLISEESAESSADMKDAE 118

Query: 124 FALSKAVDATAVSLEADSETSKSKKEKHREYENECREKCSTGKKQSHSDLENADRKTQQE 183
            ALSKAVD   +S+E  SETS SKKEKHREYEN+CREKCS    Q +S++ +   + Q+ 
Sbjct: 119 LALSKAVDVMELSMETTSETSMSKKEKHREYENKCREKCSPADMQPNSEVVDVPLQAQEL 178

Query: 184 TDSNLAGTEDSPHESGSKFDERPIEEEAVLSYQRKVTVLYELLSACLADIPQHDKKCTRQ 243
            + N    E +P+ S SKFDE+P+EE A+L+Y RKVTVLYELLSACL D P+ +KK TR+
Sbjct: 179 KNCNELSIEQTPYGSSSKFDEKPVEEVAMLNYPRKVTVLYELLSACLTDTPEDNKKSTRK 238

Query: 244 RTGYDSRHRVALRLLATWLDIKWIKMEAVEMMVASSAMAVRKAEASKEEEATSSESKWAK 303
           R GYD+RHRVALRLLATWLDI+W K+EA+E+MVA SAMA+ K +ASKEEE  S +S+W K
Sbjct: 239 RKGYDARHRVALRLLATWLDIQWKKVEAMEIMVACSAMALSKEQASKEEETQSPKSQWTK 298

Query: 304 WKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGASGFAAAASAAG 363
           WKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGT+IPVIGASGFAAAASAAG
Sbjct: 299 WKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTIIPVIGASGFAAAASAAG 358

Query: 364 TVAGSVAVAASFG--------------------------AAGAGLTGSKMARRIGSVDEF 397
           TVAGSVA+AASFG                          AAGAGLTGSKMARR GSVDEF
Sbjct: 359 TVAGSVAIAASFGGETTVTFFGLLASGILVSSTNTFINPAAGAGLTGSKMARRTGSVDEF 418

Query: 398 EFKAIGENQNQGRLAVEILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAI 457
           EFKAIGEN NQGRLAVEIL+SG VF +EDF+ PWEGQN+N+ERY LQWESKNLIAVSTAI
Sbjct: 419 EFKAIGENHNQGRLAVEILVSGFVFQEEDFISPWEGQNNNLERYALQWESKNLIAVSTAI 478

Query: 458 QDWLTSRIAMELMKQGAMMTVLKTLLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLL 517
           QDWLTS IA+ +MKQGAM+TVL TL+ ALAWPATL+ A D IDSKWTIA+DRSDKAGKLL
Sbjct: 479 QDWLTSSIALSMMKQGAMLTVLSTLMTALAWPATLLAATDFIDSKWTIALDRSDKAGKLL 538

Query: 518 AEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNW 577
           AEVL +GLQG RPVTLIGYSLGARVIFKCL+ LAE E NA +VERVVLLGAPIS +D+NW
Sbjct: 539 AEVLQKGLQGNRPVTLIGYSLGARVIFKCLQYLAETEQNAELVERVVLLGAPISFRDENW 598

Query: 578 EAVRKMVAGRFINCYATNDWTLAIAFRARYV 608
           E  RKMVAGRF+N ++TNDWTL +AFRA+YV
Sbjct: 599 EVARKMVAGRFVNAFSTNDWTLGVAFRAKYV 629

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225431211\|ref\|XP_002272351.1\| PREDICTED: transmembrane and coiled-coil domain-containing protein 4 [Vitis vinifera] gi\|297735050\|emb\|CBI17412.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224097118\|ref\|XP_002310840.1\| predicted protein [Populus trichocarpa] gi\|222853743\|gb\|EEE91290.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449515253\|ref\|XP_004164664.1\| PREDICTED: transmembrane and coiled-coil domain-containing protein 4-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|186516803\|ref\|NP_001078500.2\| uncharacterized protein [Arabidopsis thaliana] gi\|332661235\|gb\|AEE86635.1\| uncharacterized protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|255586316\|ref\|XP_002533809.1\| conserved hypothetical protein [Ricinus communis] gi\|223526263\|gb\|EEF28578.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|449457502\|ref\|XP_004146487.1\| PREDICTED: transmembrane and coiled-coil domain-containing protein 4-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|357483651\|ref\|XP_003612112.1\| Transmembrane and coiled-coil domain-containing protein [Medicago truncatula] gi\|355513447\|gb\|AES95070.1\| Transmembrane and coiled-coil domain-containing protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356561177\|ref\|XP_003548861.1\| PREDICTED: uncharacterized membrane protein F35D11.3-like [Glycine max]	Back alignment and taxonomy information

>gi\|356496683\|ref\|XP_003517195.1\| PREDICTED: uncharacterized membrane protein F35D11.3-like [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		609
TAIR\|locus:2122269		672	AT4G36210 "AT4G36210" [Arabido	0.991	0.898	0.544	2.1e-164
TAIR\|locus:2053154		656	AT2G18100 "AT2G18100" [Arabido	0.970	0.900	0.516	6.5e-154
MGI\|MGI:1924306		631	Tmco4 "transmembrane and coile	0.357	0.345	0.371	5.5e-36
RGD\|1566357		631	Tmco4 "transmembrane and coile	0.357	0.345	0.367	2.6e-35
UNIPROTKB\|Q5TGY1		634	TMCO4 "Transmembrane and coile	0.357	0.343	0.367	1.4e-34
ZFIN\|ZDB-GENE-041008-216		688	tmco4 "transmembrane and coile	0.354	0.313	0.364	6.9e-33
WB\|WBGene00018044		617	F35D11.3 [Caenorhabditis elega	0.353	0.348	0.331	2.6e-32
ASPGD\|ASPL0000008810		873	AN6268 [Emericella nidulans (t	0.316	0.221	0.358	7.8e-27
CGD\|CAL0002523		906	orf19.2574 [Candida albicans (	0.348	0.233	0.348	5.4e-25
UNIPROTKB\|Q5A991		906	CaO19.10106 "Putative uncharac	0.348	0.233	0.348	5.4e-25

TAIR\|locus:2122269 AT4G36210 "AT4G36210" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1600 (568.3 bits), Expect = 2.1e-164, P = 2.1e-164
 Identities = 335/615 (54%), Positives = 388/615 (63%)

Query:     4 TSFLSPTQRYAAGALFAIALHQAQNNQTRPLGLPXXXXXXXXXXXXXX---XXXXXXXXP 60
             TS L+PTQRYAAGALFAIAL+QAQ NQT+PLG P                         P
Sbjct:     5 TSNLTPTQRYAAGALFAIALNQAQINQTQPLGTPAAEDDDGGDEERRSNCSSGDSVSDDP 64

Query:    61 KLWVHENSGLLRPVFRFLDIDSAAWSGLEETAGCFPAKHHIGAFLRLLSEEAGDGSAQSS 120
              LWVHE SGLLRPVFR L+IDS AW GLE+TA   PAKHHIGAF RLLSEEA D SA+  
Sbjct:    65 SLWVHETSGLLRPVFRCLEIDSPAWLGLEQTACSSPAKHHIGAFTRLLSEEANDASAEMV 124

Query:   121 DQEFALSKAVDATAVSLEADSETSKSKKEKHREYENECREKCSTGKKQSHS-DLENADRK 179
             +QE AL+KA DA   S++  S +  +KKEKH+EYENECREK +  + +S   DL+    K
Sbjct:   125 EQEMALAKAADAMVHSIQC-SVSIDAKKEKHQEYENECREKYAVPEVKSKDVDLDKEKDK 183

Query:   180 TQQETDSNLAGTE------DSPHESGSKFDERPIEEEAVLSYQRKVTVLYELLSACLADI 233
              +    +   G E      D  H+     +E+ +EE  +LS+QRK+ VLYELLSACL+D 
Sbjct:   184 KEAAESAAREGLEAGVVIIDGSHKPEVLENEKSVEEVTLLSHQRKINVLYELLSACLSDK 243

Query:   234 PQHDKKCTRQRTGYDSRHRVALRLLATWLDIKWIKXXXXXXXXXXXXXXXRXXXXXXXXX 293
                DKKC R R GYD+RHRVALRLLATW +I+WIK               +         
Sbjct:   244 HHEDKKCKRCRKGYDARHRVALRLLATWFNIEWIKVEAIETMVACSAMAIQKSAEMKGED 303

Query:   294 XXXXXXXXXXWKRXXXXXXXXXXXXXXXXXXXXXXXPAIAAGFSALAPTLGTLIPVIXXX 353
                       WKR                       PAIAAGF ALAPTLGT+IPVI   
Sbjct:   304 NLTPTTSWAKWKRGGIIGAAAITGGTLMAITGGLAAPAIAAGFGALAPTLGTIIPVIGAG 363

Query:   354 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKMARRIGSVDEFEFKAIGENQNQGRLAV 413
                                             KMARRIG +DEFEFKAIGEN NQGRLAV
Sbjct:   364 GFAAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRIGDLDEFEFKAIGENHNQGRLAV 423

Query:   414 EILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQG 473
             E+L++GVVF++EDFV+PWEG   N+ERY LQWESKNLI VSTAIQDWLTSR+AMELMKQG
Sbjct:   424 EVLVAGVVFEEEDFVKPWEGLTSNLERYTLQWESKNLILVSTAIQDWLTSRLAMELMKQG 483

Query:   474 AMMTVXXXXXXXXXXXXXXVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTL 533
             AM TV              + AAD IDSKW+IA+DRSDKAG+LLAEVL +GLQG RP+TL
Sbjct:   484 AMHTVLASLLMALAWPATILVAADFIDSKWSIAIDRSDKAGRLLAEVLQKGLQGNRPITL 543

Query:   534 IGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYA 593
             +G+SLGARVIFKCL+ LAE E NA +VERVVLLGAPISI  +NW  VRKMVAGRFIN YA
Sbjct:   544 VGFSLGARVIFKCLQALAETEQNAELVERVVLLGAPISINSENWRDVRKMVAGRFINVYA 603

Query:   594 TNDWTLAIAFRARYV 608
             TNDWTL IAFRA  +
Sbjct:   604 TNDWTLGIAFRASLI 618

GO:0003674 "molecular_function" evidence=ND

GO:0008150 "biological_process" evidence=ND

GO:0009507 "chloroplast" evidence=ISM

GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=RCA

TAIR\|locus:2053154 AT2G18100 "AT2G18100" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

MGI\|MGI:1924306 Tmco4 "transmembrane and coiled-coil domains 4" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1566357 Tmco4 "transmembrane and coiled-coil domains 4" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5TGY1 TMCO4 "Transmembrane and coiled-coil domain-containing protein 4" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-041008-216 tmco4 "transmembrane and coiled-coil domains 4" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

WB\|WBGene00018044 F35D11.3 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000008810 AN6268 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

CGD\|CAL0002523 orf19.2574 [Candida albicans (taxid:5476)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5A991 CaO19.10106 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00036836001	SubName- Full=Chromosome chr4 scaffold_83, whole genome shotgun sequence; (662 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		609
pfam05277		345	pfam05277, DUF726, Protein of unknown function (DU	2e-77
COG0730		258	COG0730, COG0730, Predicted permeases [General fun	2e-05
pfam01988		209	pfam01988, VIT1, VIT family	4e-04
pfam01925		236	pfam01925, TauE, Sulfite exporter TauE/SafE	0.002
PRK13875		440	PRK13875, PRK13875, conjugal transfer protein TrbL	0.004

>gnl\|CDD\|218533 pfam05277, DUF726, Protein of unknown function (DUF726)	Back alignment and domain information

 Score =  248 bits (636), Expect = 2e-77
 Identities = 124/307 (40%), Positives = 182/307 (59%), Gaps = 17/307 (5%)

Query: 303 KWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGASGFAAAASAA 362
           K KR  +IG A L GG L+ +TGGLAAP +AAG       LG L   IG  G   +A+  
Sbjct: 2   KIKRYLLIGLAGLGGGLLIGLTGGLAAPLVAAG-------LGALFTTIGLGG---SAAFL 51

Query: 363 GTVAGSVAV-AASFGAAGAGLTGSKMARRIGSVDEFEFKAIGEN-QNQGRLAVEILISGV 420
            +  GS  V  A FGA+GAG+TG KM++R+G++  FEF  + EN +  GRL V +     
Sbjct: 52  ASTGGSAEVITALFGASGAGITGYKMSKRVGAIKTFEFIPLHENRRLSGRLIVTVSGWMR 111

Query: 421 VFDQEDFVRPWE--GQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTV 478
           + D +D   PW         + Y L+WE + L  +  A+    ++  +M L +Q    T+
Sbjct: 112 LGDYDDVRHPWRTLDPVLG-DLYSLRWEPEMLKELGQALTILASAAFSMSL-QQILGYTI 169

Query: 479 LKTLLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSL 538
           L +L++AL WP  L+    ++D+ W ++++R+ KAGK+LA+ L+    G RPVTLIG+SL
Sbjct: 170 LASLVSALQWPLALLKVGYILDNPWNVSLERAAKAGKILADALLSRNLGVRPVTLIGFSL 229

Query: 539 GARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWT 598
           GARVI+ CL  LA+ +   G++E V+LLGAP +   + WE  R +V+GRF+N Y+ NDW 
Sbjct: 230 GARVIYYCLLELAKRKA-YGLIENVILLGAPATTDAKVWEKARSVVSGRFVNGYSKNDWL 288

Query: 599 LAIAFRA 605
           L   +R 
Sbjct: 289 LGFLYRT 295

This family consists of several uncharacterized eukaryotic proteins. Length = 345

>gnl\|CDD\|223802 COG0730, COG0730, Predicted permeases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|216831 pfam01988, VIT1, VIT family	Back alignment and domain information

>gnl\|CDD\|216790 pfam01925, TauE, Sulfite exporter TauE/SafE	Back alignment and domain information

>gnl\|CDD\|237537 PRK13875, PRK13875, conjugal transfer protein TrbL; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		609
KOG2385		633	consensus Uncharacterized conserved protein [Funct	100.0
PF05277		345	DUF726: Protein of unknown function (DUF726); Inte	100.0
PF05990		233	DUF900: Alpha/beta hydrolase of unknown function (	98.81
PF01764		140	Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr	97.64
PF05057		217	DUF676: Putative serine esterase (DUF676); InterPr	97.2
PF06259		177	Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR	97.19
COG4782		377	Uncharacterized protein conserved in bacteria [Fun	97.12
cd00741		153	Lipase Lipase. Lipases are esterases that can hydr	97.1
PF00975		229	Thioesterase: Thioesterase domain; InterPro: IPR00	96.67
cd00519		229	Lipase_3 Lipase (class 3). Lipases are esterases t	96.55
PF07819		225	PGAP1: PGAP1-like protein; InterPro: IPR012908 The	96.51
PF01083		179	Cutinase: Cutinase; InterPro: IPR000675 Aerial pla	96.3
PF02450		389	LCAT: Lecithin:cholesterol acyltransferase; InterP	96.29
PLN02733		440	phosphatidylcholine-sterol O-acyltransferase	96.04
PF06028		255	DUF915: Alpha/beta hydrolase of unknown function (	95.92
PF12697		228	Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3	95.53
PLN02965		255	Probable pheophorbidase	95.39
PF00561		230	Abhydrolase_1: alpha/beta hydrolase fold A web pag	95.39
PLN02408		365	phospholipase A1	95.37
PF12695		145	Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3	95.32
cd00707		275	Pancreat_lipase_like Pancreatic lipase-like enzyme	95.27
PLN02454		414	triacylglycerol lipase	95.21
KOG2385		633	consensus Uncharacterized conserved protein [Funct	95.14
PF08237		225	PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum	95.13
PF00151		331	Lipase: Lipase; InterPro: IPR013818 Triglyceride l	95.02
COG3545		181	Predicted esterase of the alpha/beta hydrolase fol	94.87
PRK10673		255	acyl-CoA esterase; Provisional	94.69
PF11288		207	DUF3089: Protein of unknown function (DUF3089); In	94.62
PRK11126		242	2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl	94.45
TIGR03343		282	biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die	94.42
TIGR03230		442	lipo_lipase lipoprotein lipase. Members of this pr	94.33
PLN02571		413	triacylglycerol lipase	94.31
TIGR02240		276	PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer	94.19
PLN02324		415	triacylglycerol lipase	94.17
PF06821		171	Ser_hydrolase: Serine hydrolase; InterPro: IPR0106	94.0
PRK10349		256	carboxylesterase BioH; Provisional	93.82
COG1075		336	LipA Predicted acetyltransferases and hydrolases w	93.79
PRK00870		302	haloalkane dehalogenase; Provisional	93.7
PLN02802		509	triacylglycerol lipase	93.69
TIGR01838		532	PHA_synth_I poly(R)-hydroxyalkanoic acid synthase,	93.68
PLN02211		273	methyl indole-3-acetate methyltransferase	93.6
PLN02824		294	hydrolase, alpha/beta fold family protein	93.56
COG3319		257	Thioesterase domains of type I polyketide synthase	93.46
TIGR03695		251	menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene	93.38
COG3208		244	GrsT Predicted thioesterase involved in non-riboso	93.37
TIGR01250		288	pro_imino_pep_2 proline-specific peptidases, Bacil	93.37
PRK11071		190	esterase YqiA; Provisional	93.29
PRK03592		295	haloalkane dehalogenase; Provisional	93.09
PLN02162		475	triacylglycerol lipase	92.89
PLN03037		525	lipase class 3 family protein; Provisional	92.86
PLN02679		360	hydrolase, alpha/beta fold family protein	92.74
TIGR01738		245	bioH putative pimeloyl-BioC--CoA transferase BioH.	92.69
PF11187		224	DUF2974: Protein of unknown function (DUF2974); In	92.69
PF06057		192	VirJ: Bacterial virulence protein (VirJ); InterPro	92.65
PLN02310		405	triacylglycerol lipase	92.19
TIGR03056		278	bchO_mg_che_rel putative magnesium chelatase acces	92.18
PLN00413		479	triacylglycerol lipase	92.12
PLN02517		642	phosphatidylcholine-sterol O-acyltransferase	92.1
TIGR02427		251	protocat_pcaD 3-oxoadipate enol-lactonase. Members	91.91
TIGR01836		350	PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth	91.83
TIGR03101		266	hydr2_PEP hydrolase, ortholog 2, exosortase system	91.57
PF10230		266	DUF2305: Uncharacterised conserved protein (DUF230	90.97
PRK08775		343	homoserine O-acetyltransferase; Provisional	90.9
PRK10985		324	putative hydrolase; Provisional	90.79
PLN02934		515	triacylglycerol lipase	90.5
PLN03087		481	BODYGUARD 1 domain containing hydrolase; Provision	90.45
PLN02753		531	triacylglycerol lipase	90.4
PRK03204		286	haloalkane dehalogenase; Provisional	90.2
PHA02857		276	monoglyceride lipase; Provisional	90.2
TIGR01839		560	PHA_synth_II poly(R)-hydroxyalkanoic acid synthase	90.19
TIGR01392		351	homoserO_Ac_trn homoserine O-acetyltransferase. Th	89.9
PLN02578		354	hydrolase	89.76
smart00824		212	PKS_TE Thioesterase. Peptide synthetases are invol	89.69
TIGR03611		257	RutD pyrimidine utilization protein D. This protei	89.6
PLN02298		330	hydrolase, alpha/beta fold family protein	89.56
PLN02894		402	hydrolase, alpha/beta fold family protein	89.53
PLN02511		388	hydrolase	89.18
PRK10749		330	lysophospholipase L2; Provisional	88.99
PLN02719		518	triacylglycerol lipase	88.92
COG0596		282	MhpC Predicted hydrolases or acyltransferases (alp	88.9
PLN02761		527	lipase class 3 family protein	88.57
KOG2369		473	consensus Lecithin:cholesterol acyltransferase (LC	88.49
TIGR01249		306	pro_imino_pep_1 proline iminopeptidase, Neisseria-	88.26
PRK11460		232	putative hydrolase; Provisional	88.16
PRK14875		371	acetoin dehydrogenase E2 subunit dihydrolipoyllysi	88.07
PF05099		140	TerB: Tellurite resistance protein TerB; InterPro:	87.99
PRK10566		249	esterase; Provisional	87.97
TIGR01607		332	PST-A Plasmodium subtelomeric family (PST-A). Thes	87.88
cd07311		150	terB_like_1 tellurium resistance terB-like protein	87.82
COG2267		298	PldB Lysophospholipase [Lipid metabolism]	87.77
PLN02385		349	hydrolase; alpha/beta fold family protein	87.6
PRK07581		339	hypothetical protein; Validated	87.39
PF01674		219	Lipase_2: Lipase (class 2); InterPro: IPR002918 Li	87.15
PRK00175		379	metX homoserine O-acetyltransferase; Provisional	85.44
PRK06489		360	hypothetical protein; Provisional	84.69
TIGR01849		406	PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase,	84.35
KOG1454		326	consensus Predicted hydrolase/acyltransferase (alp	84.31
PLN02980		1655	2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi	82.87
PRK07868		994	acyl-CoA synthetase; Validated	82.79
PF08538		303	DUF1749: Protein of unknown function (DUF1749); In	82.73
PLN03084		383	alpha/beta hydrolase fold protein; Provisional	81.6
PF02230		216	Abhydrolase_2: Phospholipase/Carboxylesterase; Int	81.6
KOG4569		336	consensus Predicted lipase [Lipid transport and me	80.15

>KOG2385 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

Probab=100.00  E-value=2.2e-123  Score=990.56  Aligned_cols=517  Identities=44%  Similarity=0.662  Sum_probs=474.3

Q ss_pred             cchhhhhcccCcccccchhhhhCCCCCCcchhHHHHHhhhhcCCCCCCCchhHHHHHhhHHHHhhccccccccchhhhhh
Q 007295           71 LRPVFRFLDIDSAAWSGLEETAGCFPAKHHIGAFLRLLSEEAGDGSAQSSDQEFALSKAVDATAVSLEADSETSKSKKEK  150 (609)
Q Consensus        71 ~~~~~~~l~~~~~~w~g~~~~~~~~~~~~h~g~f~~~~~~~~~~~~~~~~~~e~~l~~~~~~~~~~~~~~~~~~~~~~~~  150 (609)
                      |+|+.|++.||+..||++||-+.||..+.|+++|+++..|+..|  +.+..++.++++|-|+|..+++..+...+.+++|
T Consensus         1 l~~~~~~~~~~~~~~~i~e~~~~ssq~~~~~~a~~~l~~ed~~d--s~~~~~~~~~~~a~~~~d~~l~it~l~i~~m~ek   78 (633)
T KOG2385|consen    1 LGPSDRSFPIDEYIFHIFEEKTSSSQCCSRQTAVLNLCREDFLD--SIMEEKIAALAKADDAMDSQLLITSLLIDEMREK   78 (633)
T ss_pred             CCcccccccccchhhhhhhhhccccccchhhhhHhhhhhhhhhh--HHHHHHHHhcCchhhHhhhhhhhhhhhHHHHHhh
Confidence            68999999999999999999999988899999999999998877  7777999999999999999999877899999999


Q ss_pred             hhhh-hhhhhhhccCCCCCCCccc--chhhcccccccccCCCCCCCCCCCCCCCCCCcchhhhhhhcchhHHHHHHHHHH
Q 007295          151 HREY-ENECREKCSTGKKQSHSDL--ENADRKTQQETDSNLAGTEDSPHESGSKFDERPIEEEAVLSYQRKVTVLYELLS  227 (609)
Q Consensus       151 ~~~~-~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~tvl~dL~~  227 (609)
                      |.+| +|+||++|..++++.+.-.  +.-+-+....     .+..+..+..++...+++++|++.++++++..||+.||.
T Consensus        79 ~~~~~~~~cr~~~~~~~~~~d~~~e~~~~~~ee~~~-----~E~~d~~~k~~is~~~~~V~Ev~~~~~~~st~vl~el~i  153 (633)
T KOG2385|consen   79 HAEFIENECREKFKVPEQLLDKTREHLGKTVEEHAM-----IEQIDDLCKLDISTHEKQVEEVTLLSSESSTPVLYELLI  153 (633)
T ss_pred             hhhhhhhhhHHhhhhHHHHhcccHHhhhhhHHHHHH-----HHhhcccccccccccccchhhhhhhhhccccchHHHHHH
Confidence            9999 9999999999988775331  1111111111     112244455666677889999999999999999999999


Q ss_pred             HHhccCCCccccccccCCCCChhHHHHHHHHHhhcCCCHHHHHHHHHHHHHHHHHHHHHHhhhHHHhhchhhhhhhhhhh
Q 007295          228 ACLADIPQHDKKCTRQRTGYDSRHRVALRLLATWLDIKWIKMEAVEMMVASSAMAVRKAEASKEEEATSSESKWAKWKRG  307 (609)
Q Consensus       228 ~~iad~~~~~~~~~~~~g~YDARsRvLL~~lA~~L~v~w~~l~~~E~~va~sl~~~~~e~e~~~ee~~~~~~k~~K~kR~  307 (609)
                      .|+.|...+.+.+.+++++||+|+||++++++.+|+|.|.+++..|.+++++.|+.++-++.+.++.+.++++|+|||||
T Consensus       154 a~l~~~~~~~~~~~~~~~~YD~RsRva~~L~~t~~~v~~~e~~vvet~~~~ssmelq~~~~~~se~~m~~~~~~~k~Kr~  233 (633)
T KOG2385|consen  154 ACLWTKICDLFLCCRQRGNYDSRSRVALRLLATWFDVGWFEIEVVETMLACSSMELQKSSSMKSEDVMYPRRRWKKRKRY  233 (633)
T ss_pred             HHHHHHHhhhHHHHHhhcCCChHHHHHHHHHHHHhhheeeeeeehhHHhhhhHHHHHhhhhhchhhhhchhhhHHHHHHh
Confidence            99999889999999999999999999999999999999999999999999999998887777777889999999999999


Q ss_pred             hhhhhhhhcchhhHHhhhhhhhHHHhhhhcccccccCcccccccchhHHHHHHhhhhhhhhhHHHHHhhhcccchhH-Hh
Q 007295          308 GIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGASGFAAAASAAGTVAGSVAVAASFGAAGAGLTG-SK  386 (609)
Q Consensus       308 ~~IGlAav~GG~liglTGGLAAP~IaAGlgal~~tlG~~~~~iGasG~aaaA~~lGt~aGs~avgalFGa~GagltG-~k  386 (609)
                      .+||+|+++||+|||||||||||+||||+|++++++       |++||  ||+++||++|++++++.||++||+.+| ++
T Consensus       234 ~~~GlAg~~GG~ligLTGGLaAP~IaAG~Gt~~~~i-------G~~g~--aat~~~T~aGsaav~ta~gaa~ga~~G~~k  304 (633)
T KOG2385|consen  234 IIMGLAGLGGGLLIGLTGGLAAPAIAAGIGTLFPTI-------GLGGF--AATGLGTGAGSAAVITAFGAAGGALTGMTK  304 (633)
T ss_pred             hhhhhhhcccceeeeecccchhhHHhhchhhheecc-------ccchh--hHhhHhhccchhHHHHhhccccchhcchhh
Confidence            999999999999999999999999999999877655       46777  556788999999999999999999999 99


Q ss_pred             HHhhhcCCcceEEEeccccCCCcceeEEEEEeccccCCc----cccccccccCCCcceeeeeeccHHHHHHHHHHHHHHH
Q 007295          387 MARRIGSVDEFEFKAIGENQNQGRLAVEILISGVVFDQE----DFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLT  462 (609)
Q Consensus       387 M~rr~~~V~dFeF~pL~e~~n~~rL~v~I~ISGwlt~~~----D~~~pW~~l~~~~EvYaL~WEs~~L~~LG~aI~~~l~  462 (609)
                      |.||+++|++|+|+||+   +|+|++++|+|||||-++.    +++.||..+..+.|+|+|+||+++|.++|++|+ |++
T Consensus       305 Ma~R~g~l~eFEF~pL~---en~~~~~~ltVsgw~~~~vd~~~~~v~~~d~l~~~~d~Ytl~wE~e~L~~lg~ai~-iL~  380 (633)
T KOG2385|consen  305 MAKRSGDLEEFEFRPLS---ENRRLNVILTVSGWMAGYVDDVRLFVKTWDPLTGNLDIYTLQWESEMLISLGQAIS-ILA  380 (633)
T ss_pred             HhhhcCCcceEEEEEcc---ccccCCeEEEEEEeeccccchhhhccccccccccccceeEEEecHHHHHHHHHHHH-HHH
Confidence            99999999999999995   4568999999999998764    478899999999999999999999999999999 999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHhhhhcchHHHHHHHHHHHHHHHHHHHHhhcCCCCceEEEEechhHHH
Q 007295          463 SRIAMELMKQGAMMTVLKTLLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARV  542 (609)
Q Consensus       463 s~~a~e~~kq~l~~TvLa~L~aAlawP~~Llk~a~~IDNpWsva~~RA~kaG~~LAd~L~~r~~G~RPVtLIG~SLGARV  542 (609)
                      |+++++.++|++++|||++|++|++||++|+|++|+|||||++++|||+++|++||++|+.|.||+||||||||||||||
T Consensus       381 S~~~~~~lqQ~l~~TvLasL~~A~~WP~aLlk~g~ilDnpWnia~dRa~kaG~lLAe~L~~r~qG~RPVTLVGFSLGARv  460 (633)
T KOG2385|consen  381 SEVVTESLQQVLGRTVLASLLSALQWPLALLKVGYILDNPWNIALDRADKAGELLAEALCKRSQGNRPVTLVGFSLGARV  460 (633)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHhcCchHHHhhHHHHHHHHHHHHHHHhccCCCceeEeeeccchHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhcccCCCccceEEEecccccCChhhHHHHhhcccceEEEEecCCchhhhhHhhhccC
Q 007295          543 IFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRARYV  608 (609)
Q Consensus       543 I~~cL~eLa~~~~~~giVenVvLmGaPv~~~~~~W~~~rsvVsGR~VNvYS~nDwVL~~LyRas~~  608 (609)
                      ||+||.+|++++.. ||||||||||+|++.+++.|.++|+||+|||||+||.|||+|+|+||+++.
T Consensus       461 If~CL~~Lakkke~-~iIEnViL~GaPv~~k~~~w~k~r~vVsGRFVNgYs~nDW~L~~lfRa~s~  525 (633)
T KOG2385|consen  461 IFECLLELAKKKEV-GIIENVILFGAPVPTKAKLWLKARSVVSGRFVNGYSTNDWTLGYLFRASSA  525 (633)
T ss_pred             HHHHHHHHhhcccc-cceeeeeeccCCccCCHHHHHHHHhheecceeeeeecchHHHHHHHHHhhc
Confidence            99999999998875 999999999999999999999999999999999999999999999999863

>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins	Back alignment and domain information

>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like	Back alignment and domain information

>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides []	Back alignment and domain information

>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases	Back alignment and domain information

>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria	Back alignment and domain information

>COG4782 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>cd00741 Lipase Lipase	Back alignment and domain information

>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics []	Back alignment and domain information

>cd00519 Lipase_3 Lipase (class 3)	Back alignment and domain information

>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT)	Back alignment and domain information

>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids []	Back alignment and domain information

>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2	Back alignment and domain information

>PLN02733 phosphatidylcholine-sterol O-acyltransferase	Back alignment and domain information

>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like	Back alignment and domain information

>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A	Back alignment and domain information

>PLN02965 Probable pheophorbidase	Back alignment and domain information

>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases	Back alignment and domain information

>PLN02408 phospholipase A1	Back alignment and domain information

>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A	Back alignment and domain information

>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes	Back alignment and domain information

>PLN02454 triacylglycerol lipase	Back alignment and domain information

>KOG2385 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE)	Back alignment and domain information

>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3	Back alignment and domain information

>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only]	Back alignment and domain information

>PRK10673 acyl-CoA esterase; Provisional	Back alignment and domain information

>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function	Back alignment and domain information

>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional	Back alignment and domain information

>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase	Back alignment and domain information

>TIGR03230 lipo_lipase lipoprotein lipase	Back alignment and domain information

>PLN02571 triacylglycerol lipase	Back alignment and domain information

>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase	Back alignment and domain information

>PLN02324 triacylglycerol lipase	Back alignment and domain information

>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic	Back alignment and domain information

>PRK10349 carboxylesterase BioH; Provisional	Back alignment and domain information

>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only]	Back alignment and domain information

>PRK00870 haloalkane dehalogenase; Provisional	Back alignment and domain information

>PLN02802 triacylglycerol lipase	Back alignment and domain information

>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I	Back alignment and domain information

>PLN02211 methyl indole-3-acetate methyltransferase	Back alignment and domain information

>PLN02824 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase	Back alignment and domain information

>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily	Back alignment and domain information

>PRK11071 esterase YqiA; Provisional	Back alignment and domain information

>PRK03592 haloalkane dehalogenase; Provisional	Back alignment and domain information

>PLN02162 triacylglycerol lipase	Back alignment and domain information

>PLN03037 lipase class 3 family protein; Provisional	Back alignment and domain information

>PLN02679 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH	Back alignment and domain information

>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function	Back alignment and domain information

>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins	Back alignment and domain information

>PLN02310 triacylglycerol lipase	Back alignment and domain information

>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein	Back alignment and domain information

>PLN00413 triacylglycerol lipase	Back alignment and domain information

>PLN02517 phosphatidylcholine-sterol O-acyltransferase	Back alignment and domain information

>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase	Back alignment and domain information

>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit	Back alignment and domain information

>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated	Back alignment and domain information

>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function	Back alignment and domain information

>PRK08775 homoserine O-acetyltransferase; Provisional	Back alignment and domain information

>PRK10985 putative hydrolase; Provisional	Back alignment and domain information

>PLN02934 triacylglycerol lipase	Back alignment and domain information

>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional	Back alignment and domain information

>PLN02753 triacylglycerol lipase	Back alignment and domain information

>PRK03204 haloalkane dehalogenase; Provisional	Back alignment and domain information

>PHA02857 monoglyceride lipase; Provisional	Back alignment and domain information

>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II	Back alignment and domain information

>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase	Back alignment and domain information

>PLN02578 hydrolase	Back alignment and domain information

>smart00824 PKS_TE Thioesterase	Back alignment and domain information

>TIGR03611 RutD pyrimidine utilization protein D	Back alignment and domain information

>PLN02298 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PLN02894 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PLN02511 hydrolase	Back alignment and domain information

>PRK10749 lysophospholipase L2; Provisional	Back alignment and domain information

>PLN02719 triacylglycerol lipase	Back alignment and domain information

>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>PLN02761 lipase class 3 family protein	Back alignment and domain information

>KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism]	Back alignment and domain information

>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily	Back alignment and domain information

>PRK11460 putative hydrolase; Provisional	Back alignment and domain information

>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional	Back alignment and domain information

>PF05099 TerB: Tellurite resistance protein TerB; InterPro: IPR007791 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein []	Back alignment and domain information

>PRK10566 esterase; Provisional	Back alignment and domain information

>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A)	Back alignment and domain information

>cd07311 terB_like_1 tellurium resistance terB-like protein, subgroup 1	Back alignment and domain information

>COG2267 PldB Lysophospholipase [Lipid metabolism]	Back alignment and domain information

>PLN02385 hydrolase; alpha/beta fold family protein	Back alignment and domain information

>PRK07581 hypothetical protein; Validated	Back alignment and domain information

>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids []	Back alignment and domain information

>PRK00175 metX homoserine O-acetyltransferase; Provisional	Back alignment and domain information

>PRK06489 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular	Back alignment and domain information

>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding	Back alignment and domain information

>PRK07868 acyl-CoA synthetase; Validated	Back alignment and domain information

>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function	Back alignment and domain information

>PLN03084 alpha/beta hydrolase fold protein; Provisional	Back alignment and domain information

>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases	Back alignment and domain information

>KOG4569 consensus Predicted lipase [Lipid transport and metabolism]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		609
1isp_A		181	Lipase; alpha/beta hydrolase fold, hydrolase; 1.30	3e-04

>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Length = 181	Back alignment and structure

 Score = 41.3 bits (97), Expect = 3e-04
 Identities = 20/94 (21%), Positives = 37/94 (39%), Gaps = 7/94 (7%)

Query: 476 MTVLKTLLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIG 535
              +K+ L +  W    ++A D  D   T   +      + + +VL +   G + V ++ 
Sbjct: 19  FAGIKSYLVSQGWSRDKLYAVDFWDKTGTNY-NNGPVLSRFVQKVLDET--GAKKVDIVA 75

Query: 536 YSLGARVIFKCLENLAENECNAGIVERVVLLGAP 569
           +S+G       ++NL         V  VV LG  
Sbjct: 76  HSMGGANTLYYIKNLD----GGNKVANVVTLGGA 105

PyMOL of 1isp

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		609
3icv_A		316	Lipase B, CALB; circular permutation, cleavage on	97.19
3lp5_A		250	Putative cell surface hydrolase; structural genom	97.15
1uwc_A		261	Feruloyl esterase A; hydrolase, serine esterase, x	96.99
3ds8_A		254	LIN2722 protein; unkonwn function, structural geno	96.92
1lgy_A		269	Lipase, triacylglycerol lipase; hydrolase (carboxy	96.89
1tib_A		269	Lipase; hydrolase(carboxylic esterase); 1.84A {The	96.86
1tia_A		279	Lipase; hydrolase(carboxylic esterase); 2.10A {Pen	96.82
3uue_A		279	LIP1, secretory lipase (family 3); LID-domain, hyd	96.75
3fle_A		249	SE_1780 protein; structural genomics, APC61035.1,	96.69
1tgl_A		269	Triacyl-glycerol acylhydrolase; carboxylic esteras	96.62
3g7n_A		258	Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A	96.52
1uxo_A		192	YDEN protein; hydrolase, A/B hydrolase, esterase,	96.29
3sty_A		267	Methylketone synthase 1; alpha/beta hydrolase, dec	96.19
3ils_A		265	PKS, aflatoxin biosynthesis polyketide synthase; A	96.19
3ibt_A		264	1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO,	96.18
3o0d_A		301	YALI0A20350P, triacylglycerol lipase; alpha/beta-h	96.03
1tca_A		317	Lipase; hydrolase(carboxylic esterase); HET: NAG;	95.93
2qs9_A		194	Retinoblastoma-binding protein 9; B5T overexpresse	95.92
2h1i_A		226	Carboxylesterase; structural genomics, PSI-2, prot	95.9
1ex9_A		285	Lactonizing lipase; alpha-beta hydrolase fold, pho	95.89
3bdi_A		207	Uncharacterized protein TA0194; NP_393672.1, predi	95.86
1isp_A		181	Lipase; alpha/beta hydrolase fold, hydrolase; 1.30	95.82
3ngm_A		319	Extracellular lipase; secret lipase, hydrolase; 2.	95.79
3fla_A		267	RIFR; alpha-beta hydrolase thioesterase, hydrolase	95.76
3oos_A		278	Alpha/beta hydrolase family protein; APC67239.0, p	95.74
3dqz_A		258	Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl	95.73
3tej_A		329	Enterobactin synthase component F; nonribosomal pe	95.69
2xmz_A		269	Hydrolase, alpha/beta hydrolase fold family; menaq	95.67
2wfl_A		264	Polyneuridine-aldehyde esterase; alkaloid metaboli	95.66
3c6x_A		257	Hydroxynitrilase; atomic resolution, hydroxynitril	95.65
1r3d_A		264	Conserved hypothetical protein VC1974; structural	95.64
3fsg_A		272	Alpha/beta superfamily hydrolase; PF00561, MCSG, P	95.62
3u0v_A		239	Lysophospholipase-like protein 1; alpha, beta hydr	95.62
3qit_A		286	CURM TE, polyketide synthase; thioesterase, alpha/	95.59
2x5x_A		342	PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE	95.59
1ehy_A		294	Protein (soluble epoxide hydrolase); alpha/beta hy	95.55
1jmk_C		230	SRFTE, surfactin synthetase; thioesterase, non-rib	95.55
2ocg_A		254	Valacyclovir hydrolase; alpha beta hydrolase fold;	95.53
2o2g_A		223	Dienelactone hydrolase; YP_324580.1, structural ge	95.52
3r40_A		306	Fluoroacetate dehalogenase; FACD, defluorinase, al	95.48
3u1t_A		309	DMMA haloalkane dehalogenase; alpha/beta-hydrolase	95.48
3kda_A		301	CFTR inhibitory factor (CIF); alpha/beta hydrolase	95.46
1xkl_A		273	SABP2, salicylic acid-binding protein 2; alpha-bet	95.43
2xua_A		266	PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate	95.35
3qvm_A		282	OLEI00960; structural genomics, PSI-biology, midwe	95.32
3lcr_A		319	Tautomycetin biosynthetic PKS; alpha-beta hydrolas	95.31
1iup_A		282	META-cleavage product hydrolase; aromatic compound	95.3
2ory_A		346	Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph	95.28
3bdv_A		191	Uncharacterized protein DUF1234; DUF1234 family pr	95.21
1wom_A		271	RSBQ, sigma factor SIGB regulation protein RSBQ; a	95.21
1kez_A		300	Erythronolide synthase; polyketide synthase, modul	95.11
3qmv_A		280	Thioesterase, REDJ; alpha/beta hydrolase fold, hyd	95.11
1ys1_X		320	Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h	95.09
2qvb_A		297	Haloalkane dehalogenase 3; RV2579, alpha-beta hydr	95.08
4dnp_A		269	DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu	95.07
1a8q_A		274	Bromoperoxidase A1; haloperoxidase, oxidoreductase	95.07
3l80_A		292	Putative uncharacterized protein SMU.1393C; alpha/	95.06
3tjm_A		283	Fatty acid synthase; thioesterase domain, fatty ac	95.06
1mtz_A		293	Proline iminopeptidase; alpha-beta hydrolase, CAP	95.04
3ia2_A		271	Arylesterase; alpha-beta hydrolase fold, transitio	95.03
2qjw_A		176	Uncharacterized protein XCC1541; putative hydrolas	95.02
1m33_A		258	BIOH protein; alpha-betta-alpha sandwich, structur	95.02
2puj_A		286	2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola;	95.02
2dsn_A		387	Thermostable lipase; T1 lipase, hydrolase; 1.50A {	95.0
1q0r_A		298	RDMC, aclacinomycin methylesterase; anthracycline,	94.98
3v48_A		268	Aminohydrolase, putative aminoacrylate hydrolase R	94.98
3hss_A		293	Putative bromoperoxidase; alpha beta hydrolase, ox	94.98
3g9x_A		299	Haloalkane dehalogenase; alpha/beta hydrolase, hel	94.97
3bwx_A		285	Alpha/beta hydrolase; YP_496220.1, joint center fo	94.96
1u2e_A		289	2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase	94.96
1c4x_A		285	BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di	94.95
1ei9_A		279	Palmitoyl protein thioesterase 1; alpha/beta hydro	94.94
1mj5_A		302	1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase;	94.91
1hkh_A		279	Gamma lactamase; hydrolase, alpha/beta hydrolase,	94.89
2wue_A		291	2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas	94.87
1azw_A		313	Proline iminopeptidase; aminopeptidase, serine pro	94.86
3om8_A		266	Probable hydrolase; structural genomics, PSI-2, pr	94.85
2cjp_A		328	Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu	94.84
3pe6_A		303	Monoglyceride lipase; alpha-beta hydrolase fold, 2	94.82
3fob_A		281	Bromoperoxidase; structural genomics, IDP00046, ba	94.82
1ufo_A		238	Hypothetical protein TT1662; alpha-beta fold, hydr	94.8
2hfk_A		319	Pikromycin, type I polyketide synthase pikaiv; alp	94.8
3bf7_A		255	Esterase YBFF; thioesterase, helical CAP, hydrolas	94.8
3llc_A		270	Putative hydrolase; structural genomics, joint cen	94.79
2fuk_A		220	XC6422 protein; A/B hydrolase, structural genomics	94.78
1pja_A		302	Palmitoyl-protein thioesterase 2 precursor; hydrol	94.71
3qyj_A		291	ALR0039 protein; alpha/beta fold, hydrolase; 1.78A	94.7
1j1i_A		296	META cleavage compound hydrolase; carbazole degrad	94.68
2cb9_A		244	Fengycin synthetase; thioesterase, non-ribosomal p	94.67
4f0j_A		315	Probable hydrolytic enzyme; alpha/beta hydrolase f	94.64
1a88_A		275	Chloroperoxidase L; haloperoxidase, oxidoreductase	94.64
2wj6_A		276	1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid	94.62
2hih_A		431	Lipase 46 kDa form; A1 phospholipase, phospholipid	94.61
3trd_A		208	Alpha/beta hydrolase; cellular processes; 1.50A {C	94.6
2r11_A		306	Carboxylesterase NP; 2632844, putative hydrolase,	94.59
1wm1_A		317	Proline iminopeptidase; complex with inhibitor, hy	94.55
1a8s_A		273	Chloroperoxidase F; haloperoxidase, oxidoreductase	94.53
1zoi_A		276	Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo	94.49
3r0v_A		262	Alpha/beta hydrolase fold protein; structural geno	94.49
2yys_A		286	Proline iminopeptidase-related protein; TTHA1809,	94.48
3hju_A		342	Monoglyceride lipase; alpha/beta hydrolase, hydrol	94.41
2zyr_A		484	Lipase, putative; fatty acid, hydrolase; HET: 1PE;	94.41
1imj_A		210	CIB, CCG1-interacting factor B; alpha/beta hydrola	94.39
1brt_A		277	Bromoperoxidase A2; haloperoxidase, oxidoreductase	94.35
1hpl_A		449	Lipase; hydrolase(carboxylic esterase); 2.30A {Equ	94.34
2psd_A		318	Renilla-luciferin 2-monooxygenase; alpha/beta-hydr	94.3
2qmq_A		286	Protein NDRG2, protein NDR2; alpha/beta-hydrolases	94.29
1auo_A		218	Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl	94.26
3b5e_A		223	MLL8374 protein; NP_108484.1, carboxylesterase, st	94.25
3kxp_A		314	Alpha-(N-acetylaminomethylene)succinic acid hydrol	94.24
2pl5_A		366	Homoserine O-acetyltransferase; alpha/beta hydrola	94.23
3afi_E		316	Haloalkane dehalogenase; A/B-hydrolase, hydrolase;	94.2
3h04_A		275	Uncharacterized protein; protein with unknown func	94.2
3i28_A		555	Epoxide hydrolase 2; aromatic hydrocarbons catabol	94.19
3og9_A		209	Protein YAHD A copper inducible hydrolase; alpha/b	94.11
1w52_X		452	Pancreatic lipase related protein 2; detergent, cl	94.06
3cn9_A		226	Carboxylesterase; alpha/beta hydrolase fold super-	94.04
4g9e_A		279	AHL-lactonase, alpha/beta hydrolase fold protein;	94.02
3pfb_A		270	Cinnamoyl esterase; alpha/beta hydrolase fold, hyd	94.01
3nwo_A		330	PIP, proline iminopeptidase; structural genomics,	93.93
2r8b_A		251	AGR_C_4453P, uncharacterized protein ATU2452; APC6	93.84
3p2m_A		330	Possible hydrolase; alpha/beta hydrolase superfami	93.78
2xt0_A		297	Haloalkane dehalogenase; hydrolase, alpha-beta hyd	93.73
1k8q_A		377	Triacylglycerol lipase, gastric; APHA beta hydrola	93.71
2y6u_A		398	Peroxisomal membrane protein LPX1; hydrolase, puta	93.65
1rp1_A		450	Pancreatic lipase related protein 1; hydrolase, li	93.65
2e3j_A		356	Epoxide hydrolase EPHB; epoxide hydrolase B, struc	93.61
2k2q_B		242	Surfactin synthetase thioesterase subunit; A/B-hyd	93.51
3i1i_A		377	Homoserine O-acetyltransferase; structural genomic	93.46
1fj2_A		232	Protein (acyl protein thioesterase 1); alpha/beta	93.35
1gpl_A		432	RP2 lipase; serine esterase, hydrolase, lipid degr	93.33
2b61_A		377	Homoserine O-acetyltransferase; acyl-enzyme, aspar	93.33
3b12_A		304	Fluoroacetate dehalogenase; dehalogease, hydrolase	92.34
2px6_A		316	Thioesterase domain; thioesaterse domain, orlistat	93.05
1tqh_A		247	Carboxylesterase precursor; tetrahedral intermedia	92.96
3c5v_A		316	PME-1, protein phosphatase methylesterase 1; demet	92.91
3e0x_A		245	Lipase-esterase related protein; APC60309, clostri	92.87
2q0x_A		335	Protein DUF1749, uncharacterized protein; alpha/be	92.81
2czq_A		205	Cutinase-like protein; alpha/beta hydrolase fold,	92.76
1b6g_A		310	Haloalkane dehalogenase; hydrolase, alpha/beta-hyd	92.72
4fbl_A		281	LIPS lipolytic enzyme; thermostable, structural ge	92.71
2i3d_A		249	AGR_C_3351P, hypothetical protein ATU1826; structu	92.69
1bu8_A		452	Protein (pancreatic lipase related protein 2); hyd	92.45
3dkr_A		251	Esterase D; alpha beta hydrolase, mechanism, catal	92.3
2wtm_A		251	EST1E; hydrolase; 1.60A {Clostridium proteoclastic	92.0
2rau_A		354	Putative esterase; NP_343859.1, putative lipase, s	91.96
2vat_A		444	Acetyl-COA--deacetylcephalosporin C acetyltransfer	91.72
3qpa_A		197	Cutinase; alpha-beta hydrolase fold, esterase, hyd	91.55
3d7r_A		326	Esterase; alpha/beta fold, hydrolase; 2.01A {Staph	91.43
3rm3_A		270	MGLP, thermostable monoacylglycerol lipase; alpha/	91.39
1qoz_A		207	AXE, acetyl xylan esterase; hydrolase, xylan degra	90.13
2c7b_A		311	Carboxylesterase, ESTE1; carboxyesterase, thermoph	89.99
2yij_A		419	Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid	89.5
2dst_A		131	Hypothetical protein TTHA1544; conserved hypotheti	89.98
3qpd_A		187	Cutinase 1; alpha-beta hydrolase fold, esterase, h	89.86
3i6y_A		280	Esterase APC40077; lipase, structural genomics, PS	89.8
2hm7_A		310	Carboxylesterase; alpha/beta hydrolase fold, hydro	89.53
3e4d_A		278	Esterase D; S-formylglutathione hydrolase, hydrola	89.51
1g66_A		207	Acetyl xylan esterase II; serine hydrolase, acetyl	89.47
3vdx_A		456	Designed 16NM tetrahedral protein CAGE containing	88.88
1jji_A		311	Carboxylesterase; alpha-beta hydrolase fold, hydro	88.48
1vkh_A		273	Putative serine hydrolase; structural genomics, jo	88.33
3hc7_A		254	Gene 12 protein, GP12; alpha/beta sandwich, cell a	88.31
4h0c_A		210	Phospholipase/carboxylesterase; PSI-biology, midwe	88.25
3dcn_A		201	Cutinase, cutin hydrolase; catalytic triad, secret	88.17
2pbl_A		262	Putative esterase/lipase/thioesterase; alpha/beta-	87.86
1jfr_A		262	Lipase; serine hydrolase; 1.90A {Streptomyces exfo	87.83
1jkm_A		361	Brefeldin A esterase; serine hydrolase, degradatio	87.8
2wir_A		313	Pesta, alpha/beta hydrolase fold-3 domain protein;	87.36
1tht_A		305	Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.	87.22
3ls2_A		280	S-formylglutathione hydrolase; psychrophilic organ	86.91
2ou3_A		161	Tellurite resistance protein of COG3793; structura	86.71
3f67_A		241	Putative dienelactone hydrolase; alpha-beta-alpha	86.53
4b6g_A		283	Putative esterase; hydrolase, formaldehyde detoxif	86.46
1zi8_A		236	Carboxymethylenebutenolidase; alpha and beta prote	86.27
4fle_A		202	Esterase; structural genomics, PSI-biology, northe	86.27
3bxp_A		277	Putative lipase/esterase; putative carboxylesteras	86.24
3fcx_A		282	FGH, esterase D, S-formylglutathione hydrolase; re	86.16
1lzl_A		323	Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod	86.08
4i19_A		388	Epoxide hydrolase; structural genomics, PSI-biolog	86.06
3k6k_A		322	Esterase/lipase; alpha/beta hydrolase fold; 2.20A	85.85
3hxk_A		276	Sugar hydrolase; alpha-beta protein., structural g	85.32
3ga7_A		326	Acetyl esterase; phosphoserine, IDP00896, hydrolas	85.16
2uz0_A		263	Esterase, tributyrin esterase; alpha/beta hydrolas	84.22
2fx5_A		258	Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse	84.17
3d0k_A		304	Putative poly(3-hydroxybutyrate) depolymerase LPQ;	83.96
3aja_A		302	Putative uncharacterized protein; alpha-beta hydro	83.69
1qlw_A		328	Esterase; anisotropic refinement, atomic resolutio	83.28
3n2z_B		446	Lysosomal Pro-X carboxypeptidase; alpha/beta hydro	81.07
3fak_A		322	Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc	80.45
3doh_A		380	Esterase; alpha-beta hydrolase, beta sheet; 2.60A	80.16
2h5n_A		133	Hypothetical protein PG_1108; SAD, MCSG,PSI, struc	80.14
4fhz_A		285	Phospholipase/carboxylesterase; alpha/beta hydrola	80.03
4e15_A		303	Kynurenine formamidase; alpha/beta hydrolase fold,	80.02

>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A*	Back alignment and structure

Probab=97.19  E-value=0.001  Score=68.66  Aligned_cols=72  Identities=17%  Similarity=0.134  Sum_probs=50.6

Q ss_pred             cCCCCceEEEEechhHHHHHHHHHHHHhcccCCCccceEEEecccccCCh---------------------hhH-HHHhh
Q 007295          525 LQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKD---------------------QNW-EAVRK  582 (609)
Q Consensus       525 ~~G~RPVtLIG~SLGARVI~~cL~eLa~~~~~~giVenVvLmGaPv~~~~---------------------~~W-~~~rs  582 (609)
                      ..|.++|+|||||||+.+..+.++.+.+.   ...|+.+|++|+|.....                     ..| +.+++
T Consensus       127 ~~g~~~v~LVGHSmGGlvA~~al~~~p~~---~~~V~~lV~lapp~~Gt~~a~l~~~~~~~~~a~~q~~~gS~fl~~Ln~  203 (316)
T 3icv_A          127 GSGNNKLPVLTWSQGGLVAQWGLTFFPSI---RSKVDRLMAFAPDYKGTVLAGPLDALAVSAPSVWQQTTGSALTTALRN  203 (316)
T ss_dssp             HTTSCCEEEEEETHHHHHHHHHHHHCGGG---TTTEEEEEEESCCTTCBSCC------CCCCHHHHHTBTTCHHHHHHHH
T ss_pred             HhCCCceEEEEECHHHHHHHHHHHhcccc---chhhceEEEECCCCCCchhhhhhhhccccChhHHhhCCCCHHHHHHhh
Confidence            35779999999999999998877766432   256999999999874332                     011 11221


Q ss_pred             ----cccceEEEEecCCchhh
Q 007295          583 ----MVAGRFINCYATNDWTL  599 (609)
Q Consensus       583 ----vVsGR~VNvYS~nDwVL  599 (609)
                          ...-+..++||+.|.|-
T Consensus       204 ~~~~~~~v~~tsI~S~~D~iV  224 (316)
T 3icv_A          204 AGGLTQIVPTTNLYSATDEIV  224 (316)
T ss_dssp             TTTTBCSSCEEEEECTTCSSS
T ss_pred             cCCCCCCCcEEEEEcCCCCCc
Confidence                12238999999999875

PyMOL of 3icv

>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum}	Back alignment and structure

>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A*	Back alignment and structure

>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua}	Back alignment and structure

>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A	Back alignment and structure

>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A*	Back alignment and structure

>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17	Back alignment and structure

>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A*	Back alignment and structure

>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis}	Back alignment and structure

>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A	Back alignment and structure

>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum}	Back alignment and structure

>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31	Back alignment and structure

>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A*	Back alignment and structure

>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus}	Back alignment and structure

>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida}	Back alignment and structure

>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0	Back alignment and structure

>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A*	Back alignment and structure

>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens}	Back alignment and structure

>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14	Back alignment and structure

>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18	Back alignment and structure

>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728}	Back alignment and structure

>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A	Back alignment and structure

>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae}	Back alignment and structure

>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A*	Back alignment and structure

>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis}	Back alignment and structure

>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0	Back alignment and structure

>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A	Back alignment and structure

>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus}	Back alignment and structure

>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A*	Back alignment and structure

>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ...	Back alignment and structure

>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35	Back alignment and structure

>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni}	Back alignment and structure

>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens}	Back alignment and structure

>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L}	Back alignment and structure

>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A	Back alignment and structure

>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11	Back alignment and structure

>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22	Back alignment and structure

>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A	Back alignment and structure

>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis}	Back alignment and structure

>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A	Back alignment and structure

>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified}	Back alignment and structure

>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A	Back alignment and structure

>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A*	Back alignment and structure

>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans}	Back alignment and structure

>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica}	Back alignment and structure

>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP}	Back alignment and structure

>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A	Back alignment and structure

>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP}	Back alignment and structure

>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043}	Back alignment and structure

>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A*	Back alignment and structure

>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A	Back alignment and structure

>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A*	Back alignment and structure

>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E	Back alignment and structure

>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A	Back alignment and structure

>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A	Back alignment and structure

>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12	Back alignment and structure

>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans}	Back alignment and structure

>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A	Back alignment and structure

>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A	Back alignment and structure

>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A	Back alignment and structure

>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV}	Back alignment and structure

>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26	Back alignment and structure

>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A	Back alignment and structure

>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A	Back alignment and structure

>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A*	Back alignment and structure

>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11}	Back alignment and structure

>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A	Back alignment and structure

>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A	Back alignment and structure

>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans}	Back alignment and structure

>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli}	Back alignment and structure

>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10	Back alignment and structure

>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A	Back alignment and structure

>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A	Back alignment and structure

>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A*	Back alignment and structure

>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A	Back alignment and structure

>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7	Back alignment and structure

>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0	Back alignment and structure

>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A*	Back alignment and structure

>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A*	Back alignment and structure

>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0	Back alignment and structure

>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27	Back alignment and structure

>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A	Back alignment and structure

>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A	Back alignment and structure

>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis}	Back alignment and structure

>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36	Back alignment and structure

>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13	Back alignment and structure

>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP}	Back alignment and structure

>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10	Back alignment and structure

>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A*	Back alignment and structure

>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa}	Back alignment and structure

>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12	Back alignment and structure

>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A*	Back alignment and structure

>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus}	Back alignment and structure

>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii}	Back alignment and structure

>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis}	Back alignment and structure

>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A*	Back alignment and structure

>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12	Back alignment and structure

>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A	Back alignment and structure

>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus}	Back alignment and structure

>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus}	Back alignment and structure

>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens}	Back alignment and structure

>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A*	Back alignment and structure

>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23	Back alignment and structure

>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A	Back alignment and structure

>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19	Back alignment and structure

>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A	Back alignment and structure

>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A	Back alignment and structure

>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A*	Back alignment and structure

>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14	Back alignment and structure

>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti}	Back alignment and structure

>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40	Back alignment and structure

>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A*	Back alignment and structure

>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp}	Back alignment and structure

>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A*	Back alignment and structure

>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0	Back alignment and structure

>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus}	Back alignment and structure

>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A*	Back alignment and structure

>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A	Back alignment and structure

>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A*	Back alignment and structure

>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis}	Back alignment and structure

>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14	Back alignment and structure

>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis}	Back alignment and structure

>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica}	Back alignment and structure

>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A*	Back alignment and structure

>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A*	Back alignment and structure

>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A	Back alignment and structure

>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A*	Back alignment and structure

>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A	Back alignment and structure

>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str}	Back alignment and structure

>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14	Back alignment and structure

>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A	Back alignment and structure

>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40	Back alignment and structure

>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A	Back alignment and structure

>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens}	Back alignment and structure

>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A	Back alignment and structure

>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P	Back alignment and structure

>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum}	Back alignment and structure

>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei}	Back alignment and structure

>2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP}	Back alignment and structure

>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A	Back alignment and structure

>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A	Back alignment and structure

>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36	Back alignment and structure

>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A*	Back alignment and structure

>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A	Back alignment and structure

>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A*	Back alignment and structure

>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2}	Back alignment and structure

>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A*	Back alignment and structure

>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ...	Back alignment and structure

>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp}	Back alignment and structure

>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A	Back alignment and structure

>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30	Back alignment and structure

>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon}	Back alignment and structure

>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39	Back alignment and structure

>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A	Back alignment and structure

>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A	Back alignment and structure

>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A	Back alignment and structure

>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0	Back alignment and structure

>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A*	Back alignment and structure

>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A	Back alignment and structure

>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2	Back alignment and structure

>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32	Back alignment and structure

>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29}	Back alignment and structure

>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans}	Back alignment and structure

>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A*	Back alignment and structure

>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2	Back alignment and structure

>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16	Back alignment and structure

>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2	Back alignment and structure

>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13	Back alignment and structure

>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0	Back alignment and structure

>2ou3_A Tellurite resistance protein of COG3793; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE I3A; 1.85A {Nostoc punctiforme} SCOP: a.287.1.1	Back alignment and structure

>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp}	Back alignment and structure

>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58}	Back alignment and structure

>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A*	Back alignment and structure

>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp}	Back alignment and structure

>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A*	Back alignment and structure

>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0	Back alignment and structure

>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A	Back alignment and structure

>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp}	Back alignment and structure

>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A	Back alignment and structure

>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp}	Back alignment and structure

>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium}	Back alignment and structure

>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae}	Back alignment and structure

>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina}	Back alignment and structure

>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822}	Back alignment and structure

>3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis}	Back alignment and structure

>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A*	Back alignment and structure

>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens}	Back alignment and structure

>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A	Back alignment and structure

>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A	Back alignment and structure

>2h5n_A Hypothetical protein PG_1108; SAD, MCSG,PSI, structural genomics, PR structure initiative; 2.01A {Porphyromonas gingivalis} SCOP: a.287.1.2	Back alignment and structure

>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A*	Back alignment and structure

>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		609
d1ispa_		179	Lipase A {Bacillus subtilis [TaxId: 1423]}	97.46
d1mo2a_		255	Erythromycin polyketide synthase {Saccharopolyspor	97.2
d1tcaa_		317	Triacylglycerol lipase {Yeast (Candida antarctica)	97.13
d1ex9a_		285	Lipase {Pseudomonas aeruginosa [TaxId: 287]}	96.66
d2h7xa1		283	Picromycin polyketide synthase {Streptomyces venez	96.62
d1cvla_		319	Lipase {Chromobacterium viscosum [TaxId: 42739]}	96.5
d1tiba_		269	Triacylglycerol lipase {Thermomyces lanuginosus, f	96.3
d1pjaa_		268	Palmitoyl protein thioesterase 2 {Human (Homo sapi	96.28
d1uwca_		261	Feruloyl esterase A {Aspergillus niger [TaxId: 506	95.92
d3c70a1		256	Hydroxynitrile lyase {Rubber tree (Hevea brasilien	95.91
d1brta_		277	Bromoperoxidase A2 {Streptomyces aureofaciens [Tax	95.9
d1ei9a_		279	Palmitoyl protein thioesterase 1 {Cow (Bos taurus)	95.87
d1xkta_		286	Fatty acid synthase {Human (Homo sapiens) [TaxId:	95.78
d1mtza_		290	Tricorn interacting factor F1 {Archaeon Thermoplas	95.75
d1jmkc_		230	Surfactin synthetase, SrfA {Bacillus subtilis [Tax	95.74
d1hkha_		279	Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]	95.73
d1lgya_		265	Triacylglycerol lipase {Rhizopus niveus [TaxId: 48	95.64
d3tgla_		265	Triacylglycerol lipase {Rhizomucor miehei [TaxId:	95.4
d1bu8a2		338	Pancreatic lipase, N-terminal domain {Rat (Rattus	95.3
d1tiaa_		271	Triacylglycerol lipase {Penicillium camembertii [T	95.18
d1zd3a2		322	Mammalian epoxide hydrolase, C-terminal domain {Hu	95.11
d1j1ia_		268	Meta cleavage compound hydrolase CarC {Janthinobac	95.06
d1uk8a_		271	Meta-cleavage product hydrolase CumD {Pseudomonas	95.02
d1q0ra_		297	Aclacinomycin methylesterase RdmC {Streptomyces pu	94.87
d2rhwa1		283	2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas	94.41
d1ehya_		293	Bacterial epoxide hydrolase {Agrobacterium radioba	94.38
d1mj5a_		298	Haloalkane dehalogenase {Sphingomonas paucimobilis	94.34
d1c4xa_		281	2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas	94.33
d1ku0a_		388	Lipase L1 {Bacillus stearothermophilus [TaxId: 142	94.31
d1bn7a_		291	Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1	94.27
d1rp1a2		337	Pancreatic lipase, N-terminal domain {Dog (Canis f	94.2
d1b6ga_		310	Haloalkane dehalogenase {Xanthobacter autotrophicu	94.16
d1xkla_		258	Salicylic acid-binding protein 2 (SABP2) {Common t	94.07
d1a8qa_		274	Bromoperoxidase A1 {Streptomyces aureofaciens [Tax	93.95
d1cexa_		197	Cutinase {Fungus (Fusarium solani), subsp. pisi [T	93.23
d2ou3a1		160	Tellurite resistance protein of COG3793 {Nostoc pu	92.95
d1k8qa_		377	Gastric lipase {Dog (Canis familiaris) [TaxId: 961	92.74
d1azwa_		313	Proline iminopeptidase {Xanthomonas campestris, pv	92.7
d1imja_		208	Ccg1/TafII250-interacting factor B (Cib) {Human (H	92.57
d1uxoa_		186	Hypothetical protein YdeN {Bacillus subtilis [TaxI	92.25
d1r3da_		264	Hypothetical protein VC1974 {Vibrio cholerae [TaxI	91.43
d3b5ea1		209	Uncharacterized protein Mll8374 {Mesorhizobium lot	91.27
d2h1ia1		202	Carboxylesterase {Bacillus cereus [TaxId: 1396]}	91.14
d1qoza_		207	Acetylxylan esterase {Trichoderma reesei [TaxId: 5	91.13
d1m33a_		256	Biotin biosynthesis protein BioH {Escherichia coli	90.9
d1g66a_		207	Acetylxylan esterase {Penicillium purpurogenum [Ta	89.39
d2fuka1		218	XC6422 protein {Xanthomonas campestris [TaxId: 339	88.26
d2r8ba1		203	Uncharacterized protein Atu2452 {Agrobacterium tum	86.58
d1va4a_		271	Arylesterase {Pseudomonas fluorescens [TaxId: 294]	85.77
d1a8sa_		273	Chloroperoxidase F {Pseudomonas fluorescens [TaxId	84.11
d1auoa_		218	Carboxylesterase {Pseudomonas fluorescens [TaxId:	83.89
d1tqha_		242	Carboxylesterase Est {Bacillus stearothermophilus	83.19
d1a88a_		275	Chloroperoxidase L {Streptomyces lividans [TaxId:	81.5

>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Bacterial lipase
domain: Lipase A
species: Bacillus subtilis [TaxId: 1423]

Probab=97.46  E-value=5.7e-05  Score=67.06  Aligned_cols=70  Identities=19%  Similarity=0.289  Sum_probs=48.4

Q ss_pred             CCCCceEEEEechhHHHHHHHHHHHHhcccCCCccceEEEecccccCCh-hhHHHHhhcccceEEEEecCCchhh
Q 007295          526 QGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKD-QNWEAVRKMVAGRFINCYATNDWTL  599 (609)
Q Consensus       526 ~G~RPVtLIG~SLGARVI~~cL~eLa~~~~~~giVenVvLmGaPv~~~~-~~W~~~rsvVsGR~VNvYS~nDwVL  599 (609)
                      .+.++|+|||||||+.+..+.+..+..    ...|.++|++|+|..... ..+........=++..+++++|.+.
T Consensus        65 ~~~~~v~lvGHSmGG~va~~~~~~~~~----~~~V~~~V~l~~p~~g~~~~~l~~~~~~~~~~~~~i~~~~D~~v  135 (179)
T d1ispa_          65 TGAKKVDIVAHSMGGANTLYYIKNLDG----GNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIV  135 (179)
T ss_dssp             HCCSCEEEEEETHHHHHHHHHHHHSSG----GGTEEEEEEESCCGGGTCSBCCCCSCTTCCCEEEEEEETTCSSS
T ss_pred             cCCceEEEEeecCcCHHHHHHHHHcCC----chhhCEEEEECCCCCCchhhhcCCcccccCceEEEEEecCCccc
Confidence            578899999999999999888766632    246999999999864322 1111111222336778889999765

PyMOL of d1ispa_

>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]}	Back information, alignment and structure

>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]}	Back information, alignment and structure

>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]}	Back information, alignment and structure

>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]}	Back information, alignment and structure

>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}	Back information, alignment and structure

>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]}	Back information, alignment and structure

>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]}	Back information, alignment and structure

>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]}	Back information, alignment and structure

>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]}	Back information, alignment and structure

>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]}	Back information, alignment and structure

>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]}	Back information, alignment and structure

>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]}	Back information, alignment and structure

>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]}	Back information, alignment and structure

>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]}	Back information, alignment and structure

>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]}	Back information, alignment and structure

>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]}	Back information, alignment and structure

>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]}	Back information, alignment and structure

>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]}	Back information, alignment and structure

>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}	Back information, alignment and structure

>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]}	Back information, alignment and structure

>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]}	Back information, alignment and structure

>d2ou3a1 a.287.1.1 (A:1-160) Tellurite resistance protein of COG3793 {Nostoc punctiforme pcc 73102 [TaxId: 63737]}	Back information, alignment and structure

>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]}	Back information, alignment and structure

>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]}	Back information, alignment and structure

>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]}	Back information, alignment and structure

>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]}	Back information, alignment and structure

>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]}	Back information, alignment and structure

>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]}	Back information, alignment and structure

>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]}	Back information, alignment and structure